We narrowed to 5,997 results for: ARL
-
Plasmid#58530Purposeexpresses human Noxo1 in mammalian cellsDepositorAvailable SinceAug. 25, 2014AvailabilityAcademic Institutions and Nonprofits only
-
pcDNA3.1-GoldenGate-VP64
Plasmid#47389PurposeExpression plasmid for TALE proteins fused to VP64 activation domain compatible with GoldenGate cloning systemDepositorTypeEmpty backboneUseTALENTagsFLAG, HA, and SV40 NLSExpressionMammalianPromoterCMVAvailable SinceNov. 14, 2013AvailabilityAcademic Institutions and Nonprofits only -
pLenti-CaMKIIa-C1C2-TS-EYFP
Plasmid#35520DepositorInsertChR1-ChR2 Chimera
UseLentiviralTagsTrafficking signal and EYFPExpressionMammalianPromoterCaMKIIaAvailable SinceApril 18, 2012AvailabilityAcademic Institutions and Nonprofits only -
pME-nlsGFP-P2A
Plasmid#80808Purposenuclear localization signal fused to N-terminus of GFP (nlsGFP) without stop codon, followed by P2ADepositorInsertminimal cytomegalovirus immediate early enhancer/promoter
Available SinceNov. 1, 2016AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pLPE1
Plasmid#209981PurposeContains Level 0 Part: E. coli shuttle part (pMB1_ampR_B0017) for the construction of Level 1 plasmidsDepositorInsertE. coli shuttle part (pMB1_ampR_B0017)
ExpressionBacterialAvailable SinceSept. 13, 2024AvailabilityIndustry, Academic Institutions, and Nonprofits -
pLPE2
Plasmid#209982PurposeContains Level 0 Part: E. coli shuttle part (ampR_B0017) for the construction of Level 1 plasmidsDepositorInsertE. coli shuttle part (ampR_B0017)
ExpressionBacterialAvailable SinceSept. 13, 2024AvailabilityIndustry, Academic Institutions, and Nonprofits -
pLPE3
Plasmid#209985PurposeContains Level 0* Part: E. coli shuttle part (pMB1_cat) for the construction of Level 2 plasmidsDepositorInsertE. coli shuttle part (pMB1_cat)
ExpressionBacterialAvailable SinceSept. 13, 2024AvailabilityIndustry, Academic Institutions, and Nonprofits -
pLPR3
Plasmid#209986PurposeContains Level 0* Part: resistance cassette (ermBL) for the construction of Level 2 plasmidsDepositorInsertresistance cassette (ermBL)
ExpressionBacterialAvailable SinceSept. 13, 2024AvailabilityIndustry, Academic Institutions, and Nonprofits -
AL12R-HSP70
Plasmid#161010PurposePP7-tagged reporter driven by the Arabidopsis HSP70 promoterDepositorInsertPP7 and H2B-mScarlet
ExpressionPlantAvailable SinceDec. 8, 2020AvailabilityAcademic Institutions and Nonprofits only -
pLenti-Arch-EEQ
Plasmid#45188PurposeArch voltage indicator with double mutations D95Q-D106E (Arch-EEQ), with faster kinetics and greater fluorescence dynamic range than Arch-D95NDepositorInsertenhanced Archaerhodopsin
UseLentiviralTagseYFPExpressionMammalianMutationD95Q, D106EPromoterCamKIIaAvailable SinceJuly 18, 2013AvailabilityAcademic Institutions and Nonprofits only -
pPIDCB
Plasmid#169899PurposeEmpty dox inducible vector with piggyBac, insulators, and a DTSDepositorTypeEmpty backboneUseAvian expressionExpressionMammalianPromoterDox inducibleAvailable SinceJan. 10, 2024AvailabilityAcademic Institutions and Nonprofits only -
sgRNA1_Tet-inducible Luciferase reporter
Plasmid#64161PurposePhotoactivatable transcription system. Mammalian expression of sgRNA1 to target Tet-inducible-luciferase reporter.DepositorInsertsgRNA1 for Tet-inducible Luciferase reporter
UseCRISPRExpressionMammalianPromoterhuman U6Available SinceJune 23, 2015AvailabilityAcademic Institutions and Nonprofits only -
ORF57 Pr pGL4.16
Plasmid#120378PurposeFirefly luciferase reporter with KSHV ORF57 early gene promoterDepositorInsertORF57 Promoter
UseLuciferasePromoterORF57 PromoterAvailable SinceSept. 20, 2019AvailabilityAcademic Institutions and Nonprofits only -
pDONR221-NUDT5
Plasmid#219954PurposeFor gateway cloning of NUDT5DepositorInsertNUDT5 (NUDT5 Human)
Available SinceNov. 4, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-GI-ZFP2
Plasmid#42215PurposeExpresses GI-ZFP2 for light-inducible activation of gene expressionDepositorAvailable SinceJan. 29, 2013AvailabilityAcademic Institutions and Nonprofits only -
pJP118
Plasmid#176494PurposeExpresses Lifeact-mScarlet under control of the Capsaspora EF1 promoter and HygR under control of the Capsaspora actin promoterDepositorInsertLifeact peptide
UseCapsaspora owczarzaki expressionAvailable SinceJune 6, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV MN (eGFP)
Plasmid#89932PurposeExpresses the MN fragment only of the sMTase system for targeted DNA methylation in mammalian cells. Contains a eGFP marker expressed off separate promoter.DepositorInsertMN
TagsHAExpressionMammalianMutationM.SssI residues 2-272 fragmentPromoterCMVAvailable SinceSept. 7, 2017AvailabilityAcademic Institutions and Nonprofits only -
AL13Rb-GAPC2
Plasmid#161009PurposePP7-tagged reporter driven by the Arabidopsis GAPC2 promoterDepositorInsertPP7 and H2B-mScarlet
ExpressionPlantAvailable SinceDec. 8, 2020AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-mNox1
Plasmid#58340Purposeexpresses mouse Nox1 in mammalian cellsDepositorAvailable SinceAug. 25, 2014AvailabilityAcademic Institutions and Nonprofits only