We narrowed to 18,729 results for: Mut
-
Plasmid#47760Purposemammalian expression of human PMCA4 with C-terminal 120aa deletionDepositorInsertPMCA4bct120 (ATP2B4 Human)
ExpressionMammalianMutationdeletion of C-terminal 120 aa (removes calmodulin…PromoterSV40Available SinceOct. 4, 2013AvailabilityAcademic Institutions and Nonprofits only -
pRK5-Myc-SH3BP4 W92A
Plasmid#46892Purposeexpresses Myc tagged SH3BP4 W92A mutant in mammalian cellsDepositorAvailable SinceSept. 4, 2013AvailabilityAcademic Institutions and Nonprofits only -
pET-MRPL15
Plasmid#31345DepositorInsertmitochondrial ribosomal protein L15 mature form (MRPL15 Human)
TagsHisExpressionBacterialMutationHas the amino acids in the predicted mature form …Available SinceAug. 24, 2011AvailabilityAcademic Institutions and Nonprofits only -
pET30-GBF-E6
Plasmid#21696DepositorInsertprotein G domain B1 fused human papillomavirus type 16 amno acid residue 2-142 (E6 Human papillomavirus type 16)
TagsProtein G B1 domainExpressionBacterialMutationGB1 (1-56aa) fusion tag with mutations at three p…Available SinceJuly 28, 2009AvailabilityAcademic Institutions and Nonprofits only -
UAS-u(XS)Cas9
Plasmid#127382PurposeExpresses Cas9 at very high levelDepositorInsertuORF-Cas9
UseCRISPRExpressionInsectAvailabilityAcademic Institutions and Nonprofits only -
pYL192 (TRV1)
Plasmid#148968PurposeTobacco Rattle Virus RNA 1; used for virus induced gene silencing in plants along with pYL156 (TRV RNA2)DepositorInsertTRV RNA1
UsePlant vector with trv rna1; this vector used with…MutationP697S mutation in putative replicase. S239G and S…Available SinceJune 23, 2020AvailabilityAcademic Institutions and Nonprofits only -
pLenti_Cas9_T2A_mNeonGreen_P2A_blasticidin
Plasmid#211471Purposelentiviral tricistronic complex expressing Cas9, mNeonGreen, and blasticidin resistanceDepositorInsertCas9_T2A_mNeonGreen_P2A_BlasticidinR
UseCRISPR and LentiviralTags3xFlagExpressionMammalianPromoterhU6, EF-1aAvailable SinceMarch 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
OPEN HLA-A*02:01-BirA
Plasmid#215569PurposeE. coli expression of BirA tagged HLA-A*02:01 containing a cysteine mutation for disulfide linkage to mutant beta-2 microglobulin.DepositorInsertOPEN HLA-A*02:01 (HLA-A Human)
TagsBirAExpressionBacterialMutationGlycine 120 to CysteinePromoterT7Available SinceMarch 27, 2024AvailabilityAcademic Institutions and Nonprofits only -
PB-TO-oNGN2
Plasmid#198397PurposePiggybac Tet-ON plasmid for differentiating hiPSCs into glutamatergic neurons via NGN2 expression. oNGN2 is a Phospho-mutant which avoids inhibition by cdk kinase, NGN2 optimization aided by IDT tool.InsertsTagsT2A-mycNLS-mTagBFP2ExpressionMammalianMutationS24A, S193A, S207A, S209A, S219A, S232A, S239A, S…PromoterCAG, EF1a, and TRE3GAvailable SinceApril 5, 2023AvailabilityAcademic Institutions and Nonprofits only -
HsB2AR-mCherry
Plasmid#137785PurposeVisualization of the Beta-2-adrenergic receptorDepositorAvailable SinceFeb. 27, 2020AvailabilityAcademic Institutions and Nonprofits only -
pTwist-SFFV-NFE2L18ND-Puro
Plasmid#181918PurposeLentiviral plasmid that directs the expression of mutant NFE2L1/Nrf1 where 8 putative N-glycosites are mutated from asparagine to aspartic acid in mammalian cells.DepositorInsertNFE2L1 (NFE2L1 Human)
UseLentiviralTagsFLAG and HAExpressionMammalianMutation8 putative N-glycoyslation sites converted from a…PromoterSFFVAvailable SinceApril 6, 2022AvailabilityAcademic Institutions and Nonprofits only -
GRB2-V5
Plasmid#139631PurposeV5-His-tagged gene expressionDepositorAvailable SinceMarch 24, 2020AvailabilityAcademic Institutions and Nonprofits only -
DDX41-GFP
Plasmid#175494PurposeTotal RNA was isolated from TF-1 cells and converted to cDNA using SuperScript III (Invitrogen). The full DDX41 coding sequence was cloned into pcDNA3.1 (Invitrogen) with an EGFP c-terminal insert.DepositorAvailable SinceOct. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pSIN-PAmCherry-KFERQ-NE
Plasmid#102365PurposeLentiviral overexpression of PA-mCherry-KFERQ fusionDepositorInsertsPA-mCherry
KFERQ peptide
UseLentiviralTagsNEExpressionMammalianPromoterEF-1aAvailable SinceDec. 18, 2017AvailabilityAcademic Institutions and Nonprofits only -
pRVdGL-4Cre
Plasmid#98039PurposeSecond-generation rabies viral vector genomeDepositorInsertmCre
ExpressionMammalianPromoterCMVAvailable SinceMarch 6, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCDNA3-HA-Akt1-K179M
Plasmid#73409PurposeExpresses kinase-inactive mutant of Akt with HA tagDepositorInsertAKT1 (AKT1 Human)
TagsHA tagExpressionMammalianMutationchanged K179M to make Kinase inactive mutantPromoterCMVAvailable SinceApril 20, 2016AvailabilityAcademic Institutions and Nonprofits only -
pMVS102_P3-GFP-NATMX6
Plasmid#99048PurposeEGFP reporter with six binding sites for the Zif268 DNA binding domainDepositorInsertsMcIsaac 2014 P3 promoter
eGFP
clonNAT resistance
ExpressionYeastMutationGAL1 promoter with 4 GAL4 sites removed and repla…PromoterMcIsaac 2014 P3 promoterAvailable SinceJan. 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
Lenti NG-ABE8e_P2A_GFP + PuroR
Plasmid#242000PurposeLentiviral plasmid for generation of cell lines stably expressing NG-ABE8e base editor. NG-ABE8e expression can be followed by GFP fluorescence. Contains PGK-puromycin resistance cassette.DepositorInsertNG-ABE8e
UseCRISPR and LentiviralExpressionMammalianAvailable SinceAug. 25, 2025AvailabilityAcademic Institutions and Nonprofits only -
pMini-CMV-NLS-dead R-IscB (D60A, H269A)-NLS_T2A_mCherry_U6-ωRNA
Plasmid#246430PurposeAll-in-one plasmid. Expresses R-IscB in mammalian cells. Dead mutations included.DepositorInsertsO.gue IscB with dead mutations (D60A, H269A) and delta-TID
mCherry
ωRNA
TagsSV40 NLS, Thosea asigna virus 2A peptide, and nuc…ExpressionMammalianMutationchanged Aspartic Acid 60 to Alanine, changed Hist…PromoterCMV and U6Available SinceOct. 28, 2025AvailabilityAcademic Institutions and Nonprofits only