We narrowed to 44,563 results for: INA
-
Plasmid#72098PurposeExpresses the extracellular region of the Neuropilin 2, isoform 1 protein, C-terminally fused to the Fc region of human IgG1 + 6X histidine tag.DepositorAvailable SinceFeb. 24, 2016AvailabilityAcademic Institutions and Nonprofits only
-
pAAV-TPH2-Cre
Plasmid#189616PurposeExpresses Cre recombinase under the control of the tryptophan hydroxylase promoterDepositorInsertCre Recombinase
UseAAVExpressionMammalianPromoterTph2Available SinceMarch 15, 2023AvailabilityAcademic Institutions and Nonprofits only -
pORTMAGE-3
Plasmid#72678PurposeExpresses Lambda Red recombinases and a dominant negative MutL allele all controlled by temperature sensitve cI857 repressor for high precision and efficiency MAGE experiments. Kan resistance marker.DepositorInsertmutL E32K
TagsnoneExpressionBacterialMutationE32K mutation conferring dominant mutator phenoty…Available SinceFeb. 18, 2016AvailabilityAcademic Institutions and Nonprofits only -
pTSlb-R756K
Plasmid#60731PurposeExpresses both fragments of T7 RNAP split at position 179. The N-terminal fragment is driven by PLac while the C-terminal fragment is driven by PBAD. C-terminal fragment has the point mutations R756SDepositorInsertsResidues 1-179 of split T7 RNAP
Residues 180-880 of split T7 RNAP
UseSynthetic BiologyExpressionBacterialMutationResidues 1-180 of split T7 RNAP and Residues 180-…Available SinceNov. 4, 2014AvailabilityAcademic Institutions and Nonprofits only -
pSS2.1-Cas9-HH-gRNADhps-HDV
Plasmid#241015PurposeCas9 expression cassette encoding a guide RNA targeting the Dhps locus, flanked by a hammerhead (HH) ribozyme at the 5′ end and a hepatitis delta virus (HDV) ribozyme at the 3′ endDepositorInsertsCas9-Hammerhead (HH) Ribozyme-gRNA(Dhps)-Hepatitis Delta Virus (HDV) Ribozyme
blasticidin-S deaminase
ExpressionYeastAvailable SinceNov. 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
LentiV_Neo_SIK3_CR_K95M
Plasmid#108106PurposeLentiviral expression plasmid of human SIK3 cDNA (CRISPR-resistant silent mutation & kinase-dead mutation) with neomycin resistance geneDepositorInsertSIK3 (SIK3 Human)
UseCRISPR and LentiviralExpressionMammalianMutationchange guanine 501 to cytosine (silent mutation),…PromoterEFS promoterAvailable SinceApril 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
pGEX6P1-HA-MEK1
Plasmid#53159PurposeExpresses GST-HA tagged human MEK1 from bacterial expression vectorDepositorAvailable SinceJune 12, 2014AvailabilityAcademic Institutions and Nonprofits only -
pMSCV mKeima-LC3
Plasmid#189006PurposeFluorescent reporter for autophagyDepositorInsertmKeima, LC3 (Map1lc3b Rat)
UseRetroviralAvailable SinceSept. 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
pcDNA4c/His-Xpress-HA-hBIG1(WT)
Plasmid#79431PurposeExpresses N-terminally His6, Xpress and HA-tagged BIG1(WT) in mammalian cellsDepositorAvailable SinceJune 2, 2025AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-mRuby3-Zeo
Plasmid#167206PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with mRuby3 and selection with ZeocinDepositorTypeEmpty backboneUseCRISPRTagsmRuby3ExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pIVT_superDn29-P2A-GFP
Plasmid#247162PurposeIn vitro transcription of human codon optimized engineered superDn29-P2A-GFPDepositorInsertsuperDn29-P2A-GFP
UseIn vitro transcriptionTags6xHisMutationM6I/E70G/A224P/G227V/I233K/K248R/I303K/Q332K/N341…Promotermutated T7Available SinceNov. 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-HaloTag-Puromycin
Plasmid#167208PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with HaloTag and selection with PuromycinDepositorTypeEmpty backboneUseCRISPRTagsHaloTagExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
AID-mTagBFP2-loxP_myo2_neoR-loxP
Plasmid#194055PurposeDual-selection cassette plasmid for knocking-in AID-mTagBFP2 into the C. elegans genomeDepositorAvailable SinceJan. 18, 2023AvailabilityAcademic Institutions and Nonprofits only -
pDB1 (CK2alpha)
Plasmid#27083DepositorAvailable SinceOct. 14, 2011AvailabilityAcademic Institutions and Nonprofits only -
pTwist-SFFV-NFE2L18ND-Puro
Plasmid#181918PurposeLentiviral plasmid that directs the expression of mutant NFE2L1/Nrf1 where 8 putative N-glycosites are mutated from asparagine to aspartic acid in mammalian cells.DepositorInsertNFE2L1 (NFE2L1 Human)
UseLentiviralTagsFLAG and HAExpressionMammalianMutation8 putative N-glycoyslation sites converted from a…PromoterSFFVAvailable SinceApril 6, 2022AvailabilityAcademic Institutions and Nonprofits only -
pHLmMBP-10
Plasmid#72348PurposeMammalian expression of secreted N-terminally 8His-tagged mMBP TEV cleavage site-linked fusion proteins with C-terminal 6His-tag/Strep-tag II/HA-tagDepositorTypeEmpty backboneTags6His-tag, 8His-tag, HA-tag, Strep-tag II, and mMB…ExpressionMammalianPromoterCMV enhancer + chicken beta-actin promoterAvailable SinceFeb. 17, 2016AvailabilityAcademic Institutions and Nonprofits only -
p2xFLAGhYAP1-S127A
Plasmid#17790DepositorInsertYes-kinase associated protein mutant S127A (YAP1 Human)
Tags2xFlagExpressionMammalianMutationSerine 127 to AlanineAvailable SinceMay 9, 2008AvailabilityAcademic Institutions and Nonprofits only -
pIVT_goldDn29-dCas9-P2A-GFP
Plasmid#247167PurposeIn vitro transcription of human codon optimized fusion of goldDn29-dCas9-P2A-GFPDepositorInsertgoldDn29-dCas9-P2A-GFP
UseIn vitro transcriptionTagsSV40 NLSMutationM6I/E70G/A224P/G227V/Q332K/N341K/L393P/D503NPromotermutated T7Available SinceNov. 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pFB1.HMBP.PrS.PHF19
Plasmid#125168PurposeExpresses human PHF19 in insect cells, , under a C3-cleavable (PreScission Protease) N-terminal hexahistidine-MBP tag.DepositorAvailable SinceApril 27, 2020AvailabilityAcademic Institutions and Nonprofits only