We narrowed to 44,405 results for: ina
-
Plasmid#208787PurposeInducibly expresses human Caspase 8 fused to light-activatable Cry2DepositorAvailable SinceNov. 2, 2023AvailabilityAcademic Institutions and Nonprofits only
-
pIVT_superDn29-P2A-GFP
Plasmid#247162PurposeIn vitro transcription of human codon optimized engineered superDn29-P2A-GFPDepositorInsertsuperDn29-P2A-GFP
UseIn vitro transcriptionTags6xHisMutationM6I/E70G/A224P/G227V/I233K/K248R/I303K/Q332K/N341…Promotermutated T7Available SinceNov. 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-TPH2-Cre
Plasmid#189616PurposeExpresses Cre recombinase under the control of the tryptophan hydroxylase promoterDepositorInsertCre Recombinase
UseAAVExpressionMammalianPromoterTph2Available SinceMarch 15, 2023AvailabilityAcademic Institutions and Nonprofits only -
pUCmini-iCAP-PHP.B
Plasmid#103002Purposenon-standard AAV2 rep-AAV-PHP.B cap plasmid with AAV cap expression controlled by a tTA-TRE amplification systemDepositorInsertSynthetic construct isolate AAV-PHP.B VP1 gene
UseAAVExpressionMammalianPromoterp41Available SinceFeb. 7, 2018AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-mRuby3-Zeo
Plasmid#167206PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with mRuby3 and selection with ZeocinDepositorTypeEmpty backboneUseCRISPRTagsmRuby3ExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
LentiV_Neo_SIK3_CR_K95M
Plasmid#108106PurposeLentiviral expression plasmid of human SIK3 cDNA (CRISPR-resistant silent mutation & kinase-dead mutation) with neomycin resistance geneDepositorInsertSIK3 (SIK3 Human)
UseCRISPR and LentiviralExpressionMammalianMutationchange guanine 501 to cytosine (silent mutation),…PromoterEFS promoterAvailable SinceApril 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
pORTMAGE-3
Plasmid#72678PurposeExpresses Lambda Red recombinases and a dominant negative MutL allele all controlled by temperature sensitve cI857 repressor for high precision and efficiency MAGE experiments. Kan resistance marker.DepositorInsertmutL E32K
TagsnoneExpressionBacterialMutationE32K mutation conferring dominant mutator phenoty…Available SinceFeb. 18, 2016AvailabilityAcademic Institutions and Nonprofits only -
pGEX6P1-HA-MEK1
Plasmid#53159PurposeExpresses GST-HA tagged human MEK1 from bacterial expression vectorDepositorAvailable SinceJune 12, 2014AvailabilityAcademic Institutions and Nonprofits only -
CIBN-CAAX
Plasmid#79574Purposeexpression of N-terminal portion of CIB1 with a C-terminal CAAX box from KRras for plasma-membrane targetingDepositorInsertCIBN (CIB1 Mustard Weed)
TagsC-terminal CAAX-boxExpressionMammalianMutationK93A, R94A, K106A, K107A (please see depositor co…PromoterCMVAvailable SinceJuly 29, 2016AvailabilityAcademic Institutions and Nonprofits only -
AID-mTagBFP2-loxP_myo2_neoR-loxP
Plasmid#194055PurposeDual-selection cassette plasmid for knocking-in AID-mTagBFP2 into the C. elegans genomeDepositorAvailable SinceJan. 18, 2023AvailabilityAcademic Institutions and Nonprofits only -
pMSCV mKeima-LC3
Plasmid#189006PurposeFluorescent reporter for autophagyDepositorInsertmKeima, LC3 (Map1lc3b Rat)
UseRetroviralAvailable SinceSept. 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-HaloTag-Puromycin
Plasmid#167208PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with HaloTag and selection with PuromycinDepositorTypeEmpty backboneUseCRISPRTagsHaloTagExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pTwist-SFFV-NFE2L18ND-Puro
Plasmid#181918PurposeLentiviral plasmid that directs the expression of mutant NFE2L1/Nrf1 where 8 putative N-glycosites are mutated from asparagine to aspartic acid in mammalian cells.DepositorInsertNFE2L1 (NFE2L1 Human)
UseLentiviralTagsFLAG and HAExpressionMammalianMutation8 putative N-glycoyslation sites converted from a…PromoterSFFVAvailable SinceApril 6, 2022AvailabilityAcademic Institutions and Nonprofits only -
pFB1.HMBP.PrS.PHF19
Plasmid#125168PurposeExpresses human PHF19 in insect cells, , under a C3-cleavable (PreScission Protease) N-terminal hexahistidine-MBP tag.DepositorAvailable SinceApril 27, 2020AvailabilityAcademic Institutions and Nonprofits only -
pIVT_goldDn29-dCas9-P2A-GFP
Plasmid#247167PurposeIn vitro transcription of human codon optimized fusion of goldDn29-dCas9-P2A-GFPDepositorInsertgoldDn29-dCas9-P2A-GFP
UseIn vitro transcriptionTagsSV40 NLSMutationM6I/E70G/A224P/G227V/Q332K/N341K/L393P/D503NPromotermutated T7Available SinceNov. 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pKrox24(MapErk)DsRed
Plasmid#200114PurposeFluorescent reporter for in cell monitoring of receptor tyrosine kinase-MAP ERK pathway activityDepositorInsertMapErk sequence in minimal promoter
ExpressionMammalianMutationhighly modified sequencePromoter5 copies of designed MapErk sequence, no other pr…Available SinceJune 14, 2023AvailabilityAcademic Institutions and Nonprofits only -
enDR3-TEV-mEGFP-NLS (pRS1451)
Plasmid#240546PurposeExpression of the engineered N-terminal hybrid-binding domain of RNase H3 (enDR3) for capturing R-loops. A TEV cleavage site, mEGFP and nuclear localization signal (NLS) are included in the fusion.DepositorInsertenDR3
ExpressionMammalianMutationL52MAvailable SinceAug. 28, 2025AvailabilityAcademic Institutions and Nonprofits only -
pDB1 (CK2alpha)
Plasmid#27083DepositorAvailable SinceOct. 14, 2011AvailabilityAcademic Institutions and Nonprofits only -
pORTMAGE-2
Plasmid#72677PurposeExpresses Lambda Red recombinases and a dominant negative MutL allele all controlled by temperature sensitve cI857 repressor for high precision and efficiency MAGE experiments. Ap resistance marker.DepositorInsertmutL E32K
TagsnoneExpressionBacterialMutationE32K mutation conferring dominant mutator phenoty…PromoterpL promoterAvailable SinceFeb. 18, 2016AvailabilityAcademic Institutions and Nonprofits only