We narrowed to 13,308 results for: sequence
-
Plasmid#195532PurposeCre-dependent expression of a green fluorescent, negative response-polarity voltage indicator; soma-targetedDepositorInsertAce-mNeon2-Kv2.1 proximal restriction sequence
UseAAV and Cre/LoxExpressionMammalianMutationAce-mNeon 81S; SY linkerPromoterCAGAvailable SinceJan. 31, 2023AvailabilityAcademic Institutions and Nonprofits only -
pKrox24(2xD-E)dTomato
Plasmid#200110PurposeFluorescent reporter for in cell monitoring of receptor tyrosine kinase-MAP ERK pathway activityDepositorInsertmodified EGR1 promoter
ExpressionMammalianMutationhighly modified sequencePromoter2 copies of D-E element, no other promoter elemen…Available SinceJune 29, 2023AvailabilityAcademic Institutions and Nonprofits only -
ER-HA-mNG21-10
Plasmid#141165PurposeSplit Fluorescent Reporter for ER Retrograde TraffickingDepositorInsertER-HA-mNG21-10-KDEL
UseLentiviralTagsSignal Sequence, KDEL and HAExpressionMammalianMutationK128M, S142T, R150M, G172V and K213MPromoterEf1aAvailable SinceAug. 25, 2020AvailabilityAcademic Institutions and Nonprofits only -
pTT3 Unc5B-FLAG
Plasmid#72195PurposeExpresses full-length Unc5b with a C-terminal FLAG tagDepositorAvailable SinceFeb. 23, 2016AvailabilityAcademic Institutions and Nonprofits only -
pRK5-HA-Sestrin2
Plasmid#72593Purposeoverexpression, codon optimized for mammalian expressionDepositorInsertSESN2 (SESN2 Human)
TagsHAExpressionMammalianMutationcodon optimized for mammalian expression, see dep…PromoterCMVAvailable SinceFeb. 2, 2016AvailabilityAcademic Institutions and Nonprofits only -
-
AAV-CAG-FLInChR-mVenus
Plasmid#119298PurposeFLinChR is the fusion signal sequence and transmembrane (TM) domain of Neurexin 1B-delta to ChR2E123T/T159C for inversion ChR2 to an optogenetic inhibitorDepositorInsertNx1BTM-FCS-ChR2ET/TC-mVenus
UseAAVTagsmVenusPromoterCAGAvailable SinceJan. 4, 2019AvailabilityAcademic Institutions and Nonprofits only -
pRS413-TEF1pr-MFA-NFAPoptim
Plasmid#221095PurposeFAP insert for N-terminally tagging genes of interest (optimized FAP for yeast expression + 2xMYC tag) + MFA1 signal sequence to help target constructs to the ERDepositorTypeEmpty backboneExpressionYeastAvailable SinceApril 3, 2025AvailabilityAcademic Institutions and Nonprofits only -
pTrc99S-ssDsbA-CRM197-4xDQNAT
Plasmid#128403PurposePeriplasmic expression of CRM197 with C terminal 4xDQNAT glycosylation sites in E. coliDepositorInsertDiphtheria toxin
Tags4xDQNAT glycosylation tag, 6xHis tag, and DsbA si…ExpressionBacterialMutationInactivating G52E mutationPromotertrcAvailable SinceApril 13, 2021AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only