We narrowed to 3,685 results for: gla
-
Plasmid#64987PurposeExpresses the wild type of Streptococcus pyogenes sortase A in E. coliDepositorInsertS. pyogenes sortase A
TagsHis6 tag, Mxe GyrA intein, and chitin-binding pro…ExpressionBacterialMutationdeleted amino acids 1-81PromoterT7 promoterAvailable SinceJune 5, 2015AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Nterm
Plasmid#102644PurposeEpitope tag n-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pET15b-hnRNP-F
Plasmid#23021DepositorAvailable SinceJune 4, 2010AvailabilityAcademic Institutions and Nonprofits only -
BRAF - A12G in pENTR
Plasmid#216606Purposegateway cloning donor vector containing BRAF ASD mutationDepositorAvailable SinceMarch 28, 2024AvailabilityAcademic Institutions and Nonprofits only -
pACP-ADRβ2 Control Plasmid
Plasmid#101128PurposeExpression of ACP-Tagged β2 Adrenergic Receptor in Mammalian cellsDepositorAvailable SinceSept. 27, 2017AvailabilityIndustry, Academic Institutions, and Nonprofits -
pTH1-SaSrtA-Q
Plasmid#64980PurposeExpresses the E108Q mutant of Staphylococcus aureus sortase A in E. coliDepositorInsertsortase A
TagsHis6 tag, Mxe GyrA intein, and chitin-binding pro…ExpressionBacterialMutationdeleted amino acids 1-59, E108QAvailable SinceJune 19, 2015AvailabilityAcademic Institutions and Nonprofits only -
pSP64T tBMPR (DM#135)
Plasmid#15067DepositorAvailable SinceOct. 18, 2007AvailabilityAcademic Institutions and Nonprofits only -
Pdx1-RFP hygro (DM#236)
Plasmid#15110DepositorAvailable SinceOct. 18, 2007AvailabilityAcademic Institutions and Nonprofits only -
pSC-hTDG-PreE2
Plasmid#52272PurposeBacterial expression of human TDG C-terminally fused to SUMO-E2 and GSTDepositorAvailable SinceJuly 10, 2014AvailabilityAcademic Institutions and Nonprofits only -
EC.SurA.pTYB1.a21-281&390-428.wt
Plasmid#12607DepositorInsertEscherichia coli surA delta PPIase domain 2
TagsinteinExpressionBacterialMutationresidues 282-389 deletedAvailable SinceOct. 16, 2006AvailabilityAcademic Institutions and Nonprofits only -
pTXB1-CRP/CAP
Plasmid#51563PurposeExpression of E. coli CRP/CAP for protein purification (Intein-chiting binding domain fussion, New England Biolabs pTXB1 backboneDepositorInsertCRP/CAP
TagsIntein-Chiting Binding DomaninExpressionBacterialAvailable SinceMarch 25, 2014AvailabilityAcademic Institutions and Nonprofits only -
pTXG-hTDG
Plasmid#52281PurposeBacterial expression of human TDG C-terminally fused to GyrA intein and GSTDepositorAvailable SinceJuly 10, 2014AvailabilityAcademic Institutions and Nonprofits only -
pFTK009
Plasmid#171281PurposePart Plasmid Entry Vector (LVL0) from the Fungal Modular Cloning ToolKit.DepositorInsertPglaA An03g06550 promoter
UseSynthetic BiologyExpressionBacterial and YeastMutationn/aAvailable SinceApril 21, 2022AvailabilityAcademic Institutions and Nonprofits only -
pNP1 tdTomato trigger
Plasmid#107358PurposeTrigger sequence for pNP1 tdTomato toehold switchDepositorInserttoehold trigger 5
ExpressionBacterialPromoterT7Available SinceJan. 22, 2019AvailabilityAcademic Institutions and Nonprofits only -
pNP1 Aqua trigger
Plasmid#107360PurposeTrigger sequence for pNP1 Aqua toehold switchDepositorInserttoehold trigger 8
ExpressionBacterialPromoterT7Available SinceJan. 22, 2019AvailabilityAcademic Institutions and Nonprofits only -
pNP1 OR input A
Plasmid#107365PurposeInput A for pNP1 OR gate sfGFPDepositorInsertOR gate input A
ExpressionBacterialPromoterT7Available SinceJan. 22, 2019AvailabilityAcademic Institutions and Nonprofits only -
pNP1 OR input B
Plasmid#107366PurposeInput B for pNP1 OR gate sfGFPDepositorInsertOR gate input B
ExpressionBacterialPromoterT7Available SinceJan. 22, 2019AvailabilityAcademic Institutions and Nonprofits only -
pGPS21loxFRTNeo
Plasmid#27180DepositorInsertlox/Frt/-PGK/EM7pm-G418/Kan-lox/Frt cassette flanked by Tn7L/R
UseIn vitro transposionAvailable SinceOct. 27, 2011AvailabilityAcademic Institutions and Nonprofits only -
36INS-J23100_FB
Plasmid#78668PurposeInsulated MoClo promoter for E. coli. 36nt DNA spacer empirically selected. Modified from BBa_J23100. [F:36INS-J23100:B]DepositorInsertInsulated J23100 Promoter
UseSynthetic BiologyAvailable SinceAug. 1, 2016AvailabilityAcademic Institutions and Nonprofits only -
36INS-J23100_AB
Plasmid#78666PurposeInsulated MoClo promoter for E. coli. 36nt DNA spacer empirically selected.Modified from BBa_J23100. [A:36INS-J23100:B]DepositorInsertInsulated J23100 Promoter
UseSynthetic BiologyAvailable SinceAug. 1, 2016AvailabilityAcademic Institutions and Nonprofits only