We narrowed to 8,660 results for: gal
-
Plasmid#37739DepositorInsertRab32 (Rab32 Fly)
UseDrosophilaTagsYFPExpressionInsectMutationT33N (dominant negative)PromoterGAL4Available SinceNov. 20, 2012AvailabilityAcademic Institutions and Nonprofits only -
pUASp YFP Rab32 CA
Plasmid#37740DepositorInsertRab32 (Rab32 Fly)
UseDrosophilaTagsYFPExpressionInsectMutationQ79L (constitutive active)PromoterGAL4Available SinceNov. 20, 2012AvailabilityAcademic Institutions and Nonprofits only -
pM-ErbB4CTF-PY1 mutant
Plasmid#17798DepositorInsertErbB4 (ERBB4 Human)
TagsGAL4-BDExpressionMammalianMutationCarboxy-terminal fragment, amino acids 676-1292, …Available SinceMay 9, 2008AvailabilityAcademic Institutions and Nonprofits only -
pGADT7_Sr62TK-Kinase1
Plasmid#233529PurposeExpresses Sr62TK-Kinase1 in yeastDepositorInsertSr62TK-Kinase1
TagsGAL4 AD, HA tagExpressionYeastPromoterADH1Available SinceAug. 15, 2025AvailabilityAcademic Institutions and Nonprofits only -
pLG-mLRRC45 (158 a.a.)
Plasmid#240067PurposeITT reporter plasmid for cold and osmotic stressDepositorInsertLRRC45 C-terminal 158 a.a. (Lrrc45 Mouse)
UseRetroviralTagsLexA DNA-binding (DB) domain + Gal4 transactivati…ExpressionMammalianPromoterLTRAvailable SinceJuly 29, 2025AvailabilityAcademic Institutions and Nonprofits only -
pLG-mLRRC45 (209 a.a.)
Plasmid#240068PurposeITT reporter plasmid for cold stressDepositorInsertLRRC45 C-terminal 209 a.a. (Lrrc45 Mouse)
UseRetroviralTagsLexA DNA-binding (DB) domain + Gal4 transactivati…ExpressionMammalianPromoterLTRAvailable SinceJuly 29, 2025AvailabilityAcademic Institutions and Nonprofits only -
pLG-mCCDC91 (198 a.a.)
Plasmid#240069PurposeITT reporter plasmid for cold stressDepositorInsertCCDC91 C-terminal 198 a.a. (Ccdc91 Mouse)
UseRetroviralTagsLexA DNA-binding (DB) domain + Gal4 transactivati…ExpressionMammalianPromoterLTRAvailable SinceJuly 29, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV hGRN2
Plasmid#213683PurposeExpresses human granulin-2 with an N-terminal twin-Strep-FLAG tagDepositorInserthuman Granulin-2
UseAAVTagstwin-Strep-FLAGPromotercytomegalovirus enhancer/chicken β-actin promoterAvailable SinceDec. 10, 2024AvailabilityAcademic Institutions and Nonprofits only -
pAAV GFP
Plasmid#213685PurposeExpresses Green Fluorescent Protein (GFP) with an N-terminal twin-Strep tagDepositorInsertTwin-Strep GFP
UseAAVTagsTwin-StrepPromotercytomegalovirus enhancer/chicken β-actin promoterAvailable SinceDec. 10, 2024AvailabilityAcademic Institutions and Nonprofits only -
pTol1 - 14xUAS:CaSR-EGFP
Plasmid#191502PurposeA UAS construct used to create transgenic fish that express CaSR-EGFP when crossed to a fish carrying a Gal4.DepositorInsertCaSR-EGFP-SV40
UseCreation of transgenic fish using tol1 transgenes…Promoter14X UASAvailable SinceDec. 4, 2024AvailabilityAcademic Institutions and Nonprofits only -
pDM030
Plasmid#216810PurposeVector for Aspergillus CRISPR-Cas9 genetic engineering with Golden Gate cloning drop-out cassette for protospacer insertion and ble selectable marker.DepositorTypeEmpty backboneUseCRISPR; Fungal expressionExpressionBacterialAvailable SinceSept. 5, 2024AvailabilityAcademic Institutions and Nonprofits only -
AA366
Plasmid#215970PurposeFragmid fragment: (Pol 2 promoter) Gal4-induced expressionDepositorHas ServiceCloning Grade DNAInsert5xUAS_v1; 5xUAS_v1; 5xUAS_v1; 5xUAS_v1; Hsp70_v2; Mhc_v1
UseFragmentAvailable SinceApril 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3_ERBB3-NTEV-tcs-GV-2xHA
Plasmid#214611PurposeERBB3 receptor for split TEV assayDepositorAvailable SinceFeb. 21, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3_EGFR-NTEV-tcs-GV-2xHA
Plasmid#214610PurposeEGFR receptor for split TEV assayDepositorAvailable SinceFeb. 21, 2024AvailabilityAcademic Institutions and Nonprofits only -
pTag4C_SP-HTR2A-V2R-NTEV-tcs-GV-2xHA
Plasmid#214615PurposeHTR2A receptor for split TEV assayDepositorAvailable SinceFeb. 16, 2024AvailabilityAcademic Institutions and Nonprofits only -
p10xUAS-WHaloCaMP1a-EGFP
Plasmid#205314PurposeExpression of WHaloCaMP1a-EGFP in Drosophila using GAL4 driverDepositorInsertWHaloCaMP1a-EGFP
ExpressionInsectAvailable SinceAug. 18, 2023AvailabilityAcademic Institutions and Nonprofits only -
pTL464
Plasmid#69881Purposea dCirl transcriptional reporter allele that contains an optimized gal4.2::p65 cassette at the start codon of the genomic dCirl ORFDepositorInsertCIRL (Cirl Fly)
UsePhic31-integration vectorAvailable SinceJune 24, 2022AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0869
Plasmid#177086PurposeMoClo Level 1, position 5, transcriptional unit for transient expression of 7-deoxyloganic acid hydroxylase (Cr7-DLH) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert7-deoxyloganic acid hydroxylase (Cr7-DLH) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0867
Plasmid#177085PurposeMoClo Level 1, position 3, transcriptional unit for transient expression of 7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0806
Plasmid#177080PurposeMoClo Level 1, position 3, transcriptional unit for transient expression of loganic acid O-methyltransferase (CrLAMT) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsertloganic acid O-methyltransferase (CrLAMT) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0804
Plasmid#177079PurposeMoClo Level 1, position 2, transcriptional unit for transient expression of 7-deoxyloganic acid hydroxylase (Cr7-DLH) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert7-deoxyloganic acid hydroxylase (Cr7-DLH) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0798
Plasmid#177077PurposeMoClo Level 1, position 5, transcriptional unit for transient expression of iridoid oxidase; CYP76A26 (CrIO) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsertiridoid oxidase; CYP76A26 (CrIO) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0792
Plasmid#177076PurposeMoClo Level 1, position 2, transcriptional unit for transient expression of major latex protein-like (NmMLPL) from Nepeta mussinii promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsertmajor latex protein-like (NmMLPL) from Nepeta mussinii
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0786
Plasmid#177071PurposeMoClo Level 1, position 3, transcriptional unit for transient expression of geranyl pyrophosphate synthase (PaGPPS1) from Picea abies promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsertgeranyl pyrophosphate synthase (PaGPPS1) from Picea abies
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0785
Plasmid#177070PurposeMoClo Level 1, position 2, transcriptional unit for transient expression of 1-deoxy-D-xylulose 5-phosphate synthase (CrDXS2) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert1-deoxy-D-xylulose 5-phosphate synthase (CrDXS2) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0861
Plasmid#177078PurposeMoClo Level 1, position 6, transcriptional unit for transient expression of 7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 3, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0796
Plasmid#177074PurposeMoClo Level 1, position 4, transcriptional unit for transient expression of 8-hydroxygeraniol oxidoreductase (CrGOR) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert8-hydroxygeraniol oxidoreductase (CrGOR) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 3, 2021AvailabilityAcademic Institutions and Nonprofits only -
-
CMYA5T/pACT2
Plasmid#97209PurposeCMYA5 (aa 4039 – 4069) Leu allele (4063) in a GAL4 AD vector, used for yeast-two hybridDepositorAvailable SinceAug. 21, 2017AvailabilityIndustry, Academic Institutions, and Nonprofits -
pcDNA5 FRT TO myc Separase delta 55
Plasmid#59824PurposeAllows the integration of myc Separase delta 55 in the genome and Tet-inducible expression.DepositorInsertSeparase (ESPL1 Human)
TagsMycExpressionMammalianMutationdelta 55Promoterhybrid human cytomegalovirus (CMV)/TetO2 promoterAvailable SinceFeb. 18, 2015AvailabilityAcademic Institutions and Nonprofits only -
pBD-PYR1-TSM_library
Pooled Library#241288PurposeLibrary of pBD-PYR1 triple site mutants for yeast-based sensor screensDepositorExpressionYeastSpeciesArabidopsis thalianaAvailable SinceOct. 23, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-GFP(LaG17) PAGER(TF)
Plasmid#229997PurposeExpresses anti-GFP PAGER(TF) (high reversibility) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-LaG17-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pGMβ1
Plasmid#216202PurposeChromosomal gene manipulation (gene insertion, conversion, deletion) of dairy used Lactobacillus bulgaricus, a difficult gene to manipulate, is now possible by conjugation using this pGMB1 plasmid.DepositorTypeEmpty backboneUseShuttle vector, conjugal plasmid, theta type rep…ExpressionBacterialPromoterlac promoter in pGEM-Teasy, Promoters in pAMbeta1…Available SinceJan. 21, 2025AvailabilityIndustry, Academic Institutions, and Nonprofits -
pBD-PYR1_star-MANDI
Plasmid#241280PurposeYeast two hybrid vector expressing BD-PYR1_star-MANDIDepositorAvailable SinceSept. 8, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-PDL1(KN035) PAGER(TF)
Plasmid#230003PurposeExpresses anti-PDL1 PAGER(TF) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-KN035-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
-
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-GFP(LaG2) PAGER(TF)
Plasmid#229996PurposeExpresses anti-GFP PAGER(TF) (high sensitivity) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-LaG2-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.4 human alpha5 full
Plasmid#221396PurposeMammalian expression of human integrin alpha5 full lengthDepositorInsertintegrin alpha5 full length (ITGA5 Human)
TagsCD33 secretion peptide (MPLLLLLPLLWAGALA) and St…ExpressionMammalianAvailable SinceJuly 15, 2024AvailabilityAcademic Institutions and Nonprofits only -
pYTRW22K_7Ti1
Plasmid#177293Purposegenomic integration of genes (inserted in I-SceI-site) via rrn-interposon with TcR and LacZDepositorInsertlacZ
UseSynthetic Biology; Yeast expression, rrn genomic …ExpressionBacterialAvailable SinceAug. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-mCherry(LaM8) PAGER(TF)
Plasmid#229999PurposeExpresses anti-mCherry PAGER(TF) (high reversibility) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-LaM8-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-VEGF(Nb35) PAGER(TF)
Plasmid#230000PurposeExpresses anti-VEGF PAGER(TF) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-Nb35-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pDESTN-MTp-p53-Venus
Plasmid#53736PurposeExpresses Venus tagged p53 under the metallothionein promoterDepositorAvailable SinceJune 16, 2014AvailabilityAcademic Institutions and Nonprofits only -
PD2529 human alpha5 full
Plasmid#221395PurposeMammalian expression of human integrin alpha5 full lengthDepositorInsertintegrin alpha5 full length (ITGA5 Human)
TagsCD33 secretion peptide (MPLLLLLPLLWAGALA)ExpressionMammalianAvailable SinceJuly 24, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5 FRT TO Myc ArA WT
Plasmid#59804PurposeAllows the integration of Myc ArA in the genome and Tet-inducible expressionDepositorInsertAurora A (AURKA Human)
TagsMycExpressionMammalianPromoterhybrid human cytomegalovirus (CMV)/TetO2 promoterAvailable SinceFeb. 18, 2015AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5 FRT TO Myc ArA K162R
Plasmid#59805PurposeAllows the integration of Myc ArA K162R in the genome and Tet-inducible expressionDepositorInsertAurora A (AURKA Human)
TagsMycExpressionMammalianMutationK162R, kinase mutantPromoterhybrid human cytomegalovirus (CMV)/TetO2 promoterAvailable SinceFeb. 18, 2015AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-TNFalpha(Ozoralizumab) PAGER(TF)
Plasmid#230001PurposeExpresses anti-TNFalpha PAGER(TF) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-Ozoralizumab-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-CCL2(8E10) PAGER(TF)
Plasmid#230002PurposeExpresses anti-CCL2 PAGER(TF) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-8E10-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-mCherry(LaM6) PAGER(TF)
Plasmid#229998PurposeExpresses anti-mCherry PAGER(TF) (high sensitivity) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-LaM6-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only