Showing: 41 - 60 of 205 results
-
Plasmid#105034PurposeLentiviral gRNA plasmid targeting mouse Ptpn23 , co-expression of TagBFPDepositorInsertPtpn23
UseCRISPR and LentiviralTagsExpressionMammalianMutationPromoterU6AvailabilityAcademic Institutions and Nonprofits only -
pKLV2-U6gRNA5(Pou5f1-g1)-PGKpuroBFP-W
Plasmid#105035PurposeLentiviral gRNA plasmid targeting mouse Pou5f1 , co-expression of TagBFPDepositorInsertPou5f1
UseCRISPR and LentiviralTagsExpressionMammalianMutationPromoterU6AvailabilityAcademic Institutions and Nonprofits only -
pKLV2-U6gRNA5(Nprl2-g1)-PGKpuroBFP-W
Plasmid#105037PurposeLentiviral gRNA plasmid targeting mouse Nprl2 , co-expression of TagBFPDepositorInsertNprl2
UseCRISPR and LentiviralTagsExpressionMammalianMutationPromoterU6AvailabilityAcademic Institutions and Nonprofits only -
pKLV2-U6gRNA5(Tsc2-g1)-PGKpuroBFP-W
Plasmid#105039PurposeLentiviral gRNA plasmid targeting mouse Tsc2 , co-expression of TagBFPDepositorInsertTsc2
UseCRISPR and LentiviralTagsExpressionMammalianMutationPromoterU6AvailabilityAcademic Institutions and Nonprofits only -
pKLV2-U6gRNA5(Rictor-g1)-PGKpuroBFP-W
Plasmid#105041PurposeLentiviral gRNA plasmid targeting mouse Rictor , co-expression of TagBFPDepositorInsertRictor
UseCRISPR and LentiviralTagsExpressionMammalianMutationPromoterU6AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
UseTagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
UseTagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailabilityAcademic Institutions and Nonprofits only -
pU6-TREX1 g1 Cas9-T2A-mCherry
Plasmid#164250PurposeTranscription of TREX1 guide RNA and Cas9 expression for CRISPR/Cas9 in mammalian cellsDepositorInsertsgTREX1
UseCRISPRTagsExpressionMammalianMutationPromoterU6AvailabilityAcademic Institutions and Nonprofits only -
pAS_4xG1 PylT FLAG-G1 PylRS Y125A
Plasmid#154769Purposeplasmid with 4xG1 PylT cassette and G1 PylRS Y125A for amber suppression in transient or stable, piggybac-mediated, integrationDepositorInsertG1 PylRS (MJ_RS07805 methanogenic archaeon mixed culture ISO4-G1)
UseTagsFLAGExpressionMammalianMutationY125APromoterEF1AvailabilityAcademic Institutions and Nonprofits only -
pspCas9-3exo-Tetra-com-CLCN5-sp-g1
Plasmid#176236PurposePlasmid for expressing a fusion protein of spCas9 and the 3’ exonuclease domain of POLI, and sgRNA targeting human CLCN5 gene.DepositorInsertspCas9 and polymerase exo domain fusion (CLCN5 Human)
UseTagsExpressionBacterialMutationPromoterAvailabilityAcademic Institutions and Nonprofits only -
pspCas9-5Exo-tetra-com-hCLCN5-sp-g1
Plasmid#176237PurposePlasmid for expressing a fusion protein of spCas9 and the 5’ exonuclease domain of POLI, and sgRNA targeting human CLCN5 gene.DepositorInsertspCas9 and polymerase exo domain fusion (CLCN5 Human)
UseTagsExpressionBacterialMutationPromoterAvailabilityAcademic Institutions and Nonprofits only -
pspCas9-Exo-tetra-com-hCLCN5-sp-g1
Plasmid#176238PurposePlasmid for expressing a fusion protein of spCas9 and the 5’ and 3’ exonuclease domain of POLI, and sgRNA targeting human CLCN5 gene.DepositorInsertspCas9 and polymerase exo domain fusion (CLCN5 Human)
UseTagsExpressionBacterialMutationPromoterAvailabilityAcademic Institutions and Nonprofits only -
pAS_4xhybPylT A41AA C55A FLAG-G1 PylRS Y125A
Plasmid#154773Purposeplasmid with 4xhybrid PylT cassette (Mx1201 G1 PylT hybrid mutant A41AA C55A) and G1 PylRS Y125A for amber suppression in transient or stable, piggybac-mediated, integrationDepositorInsertG1 PylRS (MJ_RS07805 methanogenic archaeon mixed culture ISO4-G1)
UseTagsFLAGExpressionMammalianMutationY125A in G1PylS, hybrid PylT with A41AA and C55A …PromoterEF1AvailabilityAcademic Institutions and Nonprofits only -
XLone-Puro Cas13d-eGFP U6 RUNX1 g1
Plasmid#155185PurposePiggybacTransposon-based tunable and temporal expression control of Cas13d- eGFP and RUNX1 gRNA1DepositorInsertCas13d RUNX1 gRNA1
UsePiggybac transposonTagsExpressionMammalianMutationPromoterU6AvailabilityAcademic Institutions and Nonprofits only -
XLone-Puro Cas13d-eGFP U6 SOX17 g1
Plasmid#155187PurposePiggybacTransposon-based tunable and temporal expression control of Cas13d- eGFP and SOX17 gRNA1DepositorInsertCas13d SOX17 gRNA1
UsePiggybac transposonTagsExpressionMammalianMutationPromoterU6AvailabilityAcademic Institutions and Nonprofits only -
pET28 MBP NAAEF-AMPKa1 (13-476,529-550)-b2(76-272)-g1(24-327)
Plasmid#177850PurposeBacterial Expression of AMPKDepositorInsertAMPK (a1b2g1)
UseTagsMBPExpressionBacterialMutationPromoterAvailabilityAcademic Institutions and Nonprofits only -
pRPR1_g1gRNA_RPR1t
Plasmid#64387Purposeencodes g1 gRNADepositorInsertg1 gRNA
UseTagsExpressionYeastMutationPromoterAvailabilityAcademic Institutions and Nonprofits only -
pCW57-Cx32-IRES-GCaMP6s
Plasmid#216795PurposeInducible bicistronic lentiviral plasmid for the simultaneous expression of Connexin 32 and cytosolic GCaMP6sDepositorInsertConnexin 32-IRES-GCaMP6s (GJB1 Human)
UseLentiviralTagsExpressionMutationPromoterAvailabilityAcademic Institutions and Nonprofits only -
eSpCas9(1.1)_NoFlag_ATP1A1_G3_SLBP_G1_Dual_sgRNA
Plasmid#191528PurposeVector for tandem expression of SLBP 3'UTR G1 sgRNA in combination with ATP1A1 G3 sgRNA from two independent U6 promoters to facilitate SLBP endogenous tagging by marker free coselection using ouabainDepositorInsertSLBP 3'UTR G1 sgRNA + ATP1A1 G3 sgRNA + FLAGless enhanced specificity Cas9 (1.1)
UseCRISPR; Co-selection via hdr using ouabainTagsExpressionMammalianMutationPromoterAvailabilityAcademic Institutions and Nonprofits only -
pCW57-Cx32D178Y-IRES-GCaMP6s
Plasmid#216796PurposeInducible bicistronic lentiviral plasmid for the simultaneous expression of the D178Y mutant form of Connexin 32 and cytosolic GCaMP6sDepositorInsertCx32D178Y-IRES-GCaMP6s (GJB1 Human)
UseLentiviralTagsExpressionMutationD178Y mutant form of Connexin 32PromoterAvailabilityAcademic Institutions and Nonprofits only
Showing: 41 - 60 of 205 results