We narrowed to 17,982 results for: IGH@
-
Plasmid#205025PurposeExpressing engineered M.EcoGII with higher thermostabilityDepositorInsertAncestral M.EcoGII 250
TagsHis6x tagExpressionBacterialPromoterT7Available SinceOct. 18, 2024AvailabilityAcademic Institutions and Nonprofits only -
pTIPI_mK-Anti_DYKDDDDK [M2]
Plasmid#210655PurposeMammalian expression of Anti-DYKDDDDK [M2] kappa light chain; to be used with pTIPI_mIGg2a_Anti-DYKDDDDK [M2] heavy chain (Plasmid 210654) to make the antibody.DepositorInsertAnti-DYKDDDDK [M2] kappa light chain
UseAffinity Reagent/ AntibodyTagsMouse kappa light chainExpressionMammalianPromoterCMVAvailable SinceAug. 18, 2025AvailabilityIndustry, Academic Institutions, and Nonprofits -
pREDusk-AmpR-MCS
Plasmid#188974PurposeFor red light-repressed bacterial expression of gene of interest (AmpR)DepositorTypeEmpty backboneExpressionBacterialAvailable SinceSept. 26, 2022AvailabilityAcademic Institutions and Nonprofits only -
pLenti-dCas9-KRAB-gRNA-TRE-blast
Plasmid#201152PurposeLentiviral expression of S. pyogenes dead Cas9 (dCas9/dSpCas9/SpdCas9) fused to the KRAB domain as well as a gRNA targeting the tight TRE promoter and the blasticidin resistance gene.DepositorInsertsdCas9-KRAB
gRNA-TRE
UseCRISPR and LentiviralTagsHAMutationgRNA sequence: TACGTTCTCTATCACTGATAvailable SinceJuly 25, 2023AvailabilityAcademic Institutions and Nonprofits only -
pJLG029
Plasmid#192980PurposeBHR plasmid (pRA301) expressing pruR-3XFLAG from T7 promoter for high yield protein purificationDepositorInsertpruR-3xFLAG
Tags3XFLAGExpressionBacterialPromoterT7Available SinceNov. 28, 2022AvailabilityAcademic Institutions and Nonprofits only -
pGP-FB-orig BA
Plasmid#13420DepositorInsertorig BA
TagsGal11PExpressionBacterialAvailable SinceFeb. 8, 2007AvailabilityAcademic Institutions and Nonprofits only -
ttAtCas12a+int
Plasmid#182384PurposeGives very high editing efficiency in barley. Also works in Brassica oleraceaDepositorInsertLbCas12a coding sequence with D156R and Arabidopsis introns
UseCRISPRMutationD156R + 8 Arabidopsis introns addedPromoterNoneAvailable SinceJuly 11, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV-iGlu3Fast
Plasmid#226500PurposeUltrafast-decay iGluSnFR3 variant for tracking high frequency synaptic glutamate releaseDepositorInsertiGluSnFR3 S72T
TagsIgK, Myc tag, and PDGFR Beta TM domainExpressionMammalianMutationS72TPromoterCMVAvailable SinceOct. 11, 2024AvailabilityAcademic Institutions and Nonprofits only -
ReNL_pRSETb
Plasmid#89536PurposeRed color variant of bright luminescent protein for bacterial expressionDepositorInsertReNL
TagsHis X 6ExpressionBacterialPromoterT7Available SinceMay 9, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCalpha EV (PKA catalytic subunit Calpha)
Plasmid#15310DepositorInsertPRKACA (Prkaca Mouse)
ExpressionMammalianAvailable SinceJuly 6, 2007AvailabilityAcademic Institutions and Nonprofits only -
pREDusk-StrR-MCS
Plasmid#188972PurposeFor red light-repressed bacterial expression of gene of interest (StrR)DepositorTypeEmpty backboneExpressionBacterialAvailable SinceSept. 26, 2022AvailabilityAcademic Institutions and Nonprofits only -
YeNL_pRSETb
Plasmid#89520PurposeYellow color variant of bright luminescent protein for bacterial expressionDepositorInsertYeNL
TagsHis X 6ExpressionBacterialPromoterT7Available SinceMay 4, 2017AvailabilityAcademic Institutions and Nonprofits only -
pGDP3 arr
Plasmid#112890PurposeThis plasmid is part of the Minimal Antibiotic Resistance Platform (ARP) Kit (Addgene #1000000143). Low copy-number plasmid that constitutively expresses genes using the Pbla promoter.DepositorInsertarr
Tags6xHisExpressionBacterialPromoterPblaAvailable SinceDec. 10, 2018AvailabilityAcademic Institutions and Nonprofits only -
pGDP1 stat
Plasmid#112886PurposeThis plasmid is part of the Minimal Antibiotic Resistance Platform (ARP) Kit (Addgene #1000000143). Low copy-number plasmid that constitutively expresses genes using the Pbla promoter.DepositorInsertstat
Tags6xHisExpressionBacterialPromoterPblaAvailable SinceDec. 10, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCbeta EV (PKA catalytic subunit Cbeta)
Plasmid#15311DepositorInsertPRKACB (Prkacb Mouse)
ExpressionMammalianAvailable SinceJuly 6, 2007AvailabilityAcademic Institutions and Nonprofits only -
pLenti-dSaCas9-KRAB-gRNA-TRE-blast
Plasmid#201151PurposeLentiviral expression of S. aureus dead Cas9 (dCas9/dSaCas9/SadCas9) fused to the KRAB domain as well as a gRNA targeting the tight TRE promoter and the blasticidin resistance gene.DepositorInsertsSadCas9-KRAB
gRNA-TRE
UseCRISPR and LentiviralTagsHAMutationgRNA sequence: ATCAGTGATAGAGAACGTATGAvailable SinceJuly 25, 2023AvailabilityAcademic Institutions and Nonprofits only -
pGL2B -938/+64
Plasmid#24943DepositorAvailable SinceAug. 18, 2010AvailabilityAcademic Institutions and Nonprofits only -
OeNL_pRSETb
Plasmid#89529PurposeOrange color variant of bright luminescent protein for bacterial expressionDepositorInsertOeNL
TagsHis X 6ExpressionBacterialPromoterT7Available SinceApril 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Nterm
Plasmid#102644PurposeEpitope tag n-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
CD200Cd4d3+4-bio
Plasmid#32404PurposeA positive control receptor bait (rat CD4d3+4-bio) and prey (rat CD200) EXPRESs plasmid for The Basic AVEXIS kitDepositorInsertCD200
TagsCd4d3+4 and biotinylation peptideExpressionMammalianPromoterCMVAvailable SinceJan. 17, 2012AvailabilityAcademic Institutions and Nonprofits only