We narrowed to 81,735 results for: TRI
-
Plasmid#219436PurposeCRISPR-associated transposases from V. cholerae and used for RNA guided cargo insertion in Vibrio natriegensDepositorInserttwo transposon ends, LoxP-terminator-LoxP gene cassette
ExpressionBacterialAvailable SinceJune 4, 2024AvailabilityAcademic Institutions and Nonprofits only -
pVH231-Tier1-PmPGK1-mTagBFP2
Plasmid#169520PurposeTier-1 vector encoding PmPGK1-driven mTagBFP2 expression (PmPGK1-mTagBFP2-pA).DepositorInsertPPGK-driven monomeric Tag blue fluorescent protein 2
ExpressionMammalianPromoterPPGKAvailable SinceJune 16, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV3Tag8li-hSAPS1-HA
Plasmid#165466PurposeHuman SAPS1 mammalian expression vector with C-terminal HA tag.DepositorInsertProtein phosphatase 6 regulatory subunit 1 (PPP6R1 Human)
TagsHAExpressionMammalianPromoterCMVAvailable SinceMarch 11, 2021AvailabilityAcademic Institutions and Nonprofits only -
pJB158
Plasmid#202601PurposeRP4-based mobilizable plasmid for the IPTG inducible expression of inserts that can be introduced using BsaI-based Golden Gate cloning. Vector has two origins of replication.DepositorTypeEmpty backboneExpressionBacterialAvailable SinceOct. 27, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCMV4a-SIRT6-G60A-FLAG
Plasmid#102323PurposeHuman SIRT6 G60A with FLAG tag for mammalian expressionDepositorInsertSIRT6 (SIRT6 Human)
TagsFLAGExpressionMammalianMutationchanged glycine 60 to alaninePromoterCMVAvailable SinceOct. 12, 2018AvailabilityAcademic Institutions and Nonprofits only -
pJFRC-20X-UAS-ADARcd
Plasmid#81173Purposeidentification of cell-specific targets of RNA binding proteinsDepositorInsertUAS-ADARcd
ExpressionInsectPromoterUASAvailable SinceAug. 12, 2016AvailabilityAcademic Institutions and Nonprofits only -
pGEX-6p-1 Sesn2
Plasmid#61873Purposebacterial expression of a GST-Sesn2 (mouse)DepositorAvailable SinceJan. 20, 2015AvailabilityAcademic Institutions and Nonprofits only -
HBT-GCaMP6-HA
Plasmid#107433PurposeFor Arabidopsis mesophyll protoplast transient expression assayDepositorInsertGCaMP6S
TagsHAExpressionBacterialAvailable SinceSept. 27, 2018AvailabilityAcademic Institutions and Nonprofits only -
mLPx-shZMPSTE24
Plasmid#69067Purposeencodes a shRNA against the protease ZMPSTE24DepositorAvailable SinceJan. 5, 2016AvailabilityAcademic Institutions and Nonprofits only -
pIIS18-BsaI
Plasmid#128649PurposeEntry vector useful for golden gate or other seamless cloning technique based on Type IIS restriction enzymesDepositorTypeEmpty backboneUseUnspecifiedAvailable SinceOct. 9, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCVL SFFV HA.NLS.I-AniIY2(reo).T2A.TagBFP
Plasmid#31477DepositorInsertSFFV HA NLS Y2 T2A mTagBFP
UseLentiviralTagsHA and NLSMutationF13Y + S111Y on I-AniI = Y2 "reo" (res…Available SinceAug. 22, 2011AvailabilityAcademic Institutions and Nonprofits only -
pTS2386-Tier1-PhCMV-GCaMP6s
Plasmid#169519PurposeTier-1 vector encoding PhCMV-driven calcium sensor GCaMP6s (PhCMV-GCaMP6s-pA).DepositorInsertPCMV-driven green fluorescent genetically encoded calcium indicator GCaMP6s
ExpressionMammalianPromoterPhCMVAvailable SinceJune 16, 2022AvailabilityAcademic Institutions and Nonprofits only -
pLPC31
Plasmid#209996PurposeContains Level 0 Part: 3' Connector (3C2SN) for the construction of Level 1 plasmidsDepositorInsert3' Connector (3C2SN)
ExpressionBacterialAvailable SinceJan. 17, 2024AvailabilityAcademic Institutions and Nonprofits only -
pLPC32
Plasmid#209997PurposeContains Level 0 Part: 3' Connector (3C5CSN) for the construction of Level 1 plasmidsDepositorInsert3' Connector (3C5CSN)
ExpressionBacterialAvailable SinceJan. 17, 2024AvailabilityAcademic Institutions and Nonprofits only -
pLPC52
Plasmid#209991PurposeContains Level 0 Part: 5' Connector (5C2SN) for the construction of Level 1 plasmidsDepositorInsert5' Connector (5C2SN)
ExpressionBacterialAvailable SinceJan. 17, 2024AvailabilityAcademic Institutions and Nonprofits only -
pLPC51
Plasmid#209990PurposeContains Level 0 Part: 5' Connector (5C1CSN) for the construction of Level 1 plasmidsDepositorInsert5' Connector (5C1CSN)
ExpressionBacterialAvailable SinceJan. 17, 2024AvailabilityAcademic Institutions and Nonprofits only -
pTK162_mCherry-4.1G-hardened
Plasmid#46361DepositorInsert4.1G (EPB41L2 Human)
TagsmCherryExpressionMammalianMutationModified for siRNA resistance to gcTccTcaTttCgaAc…PromoterCMVAvailable SinceJuly 31, 2013AvailabilityAcademic Institutions and Nonprofits only -
pLenti-CMV-GFP-2A-oG-WPRE
Plasmid#102984PurposeLentivirus expressing eGFP and optimised Rabies Glycoprotein (oG)DepositorInsertsEnhanced Green Fluorescent Protein (eGFP)
Optimised Rabies glycoprotein (oG)
UseLentiviralAvailable SinceDec. 8, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -