We narrowed to 6,520 results for: sas;
-
Plasmid#190191PurposePlasmid for the expression of His-TEV-mCherry-OPTN WT. Internal reference: SMC797DepositorInsertoptineurin (OPTN Human)
UseTags6xHis, TEV, and mCherryExpressionBacterialMutationPromoterAvailable SinceNov. 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
mcherry p62 delta UBA silent
Plasmid#187984Purposemcherry p62 lacking UBA domain (aa389-434) but it has the silent mutations to be resistant to sip62. Internal reference: SMC572DepositorInsertp62 (NUP62 Human)
UseTagsmCherryExpressionMammalianMutationLacking UBA domain (aa389-434) but it has the sil…PromoterAvailable SinceOct. 14, 2022AvailabilityAcademic Institutions and Nonprofits only -
mcherry-p62 delta PB1 silent
Plasmid#187985Purposehuman p62 lacking PB1 domain (=aa1-102) with a silent mutation to get resistance for sip62 #5 (Dharmacon). Internal Reference: SMC552DepositorInsertp62 (NUP62 Human)
UseTagsmCherryExpressionMammalianMutationLacking PB1 domain (aa1-102) with a silent mutati…PromoterAvailable SinceOct. 14, 2022AvailabilityAcademic Institutions and Nonprofits only -
mCh-LgBiT-2A-EGFP-Vin-PILATeS-CT
Plasmid#216763PurposePiggyBac vector for stable co-expression of mCherry-LgBiT and EGFP-Vinculin-PILATeS-CT (700 pM) negative control in mammalian cells. Requires transposaseDepositorInsertmCherry-LgBiT-P2A-T2A-EGFP-Vin-PILATeS-CT
UseTagsEGFP and mCherryExpressionMammalianMutationPromoterAvailable SinceAug. 13, 2024AvailabilityAcademic Institutions and Nonprofits only -
pPBJ pFOS-KTR-Gal4-PEST-tub3’ pCMV-TagBFP
Plasmid#176531PurposePiggyBAC vector expressing a FOS promoter driven "KGV" synthetic transcription factor and a CMV promoter driven BFP marker.DepositorInsertsKGV transcription factor
TagBFP
UsePiggybac transposase integration vectorTagsErkKTR, Gal4 DNA binding domain, PEST destabiliza…ExpressionMammalianMutationPromoterAvailable SinceMarch 7, 2024AvailabilityAcademic Institutions and Nonprofits only -
pET-Duet1_6xHis-TEV-GABARAP-Gly
Plasmid#190930PurposePlasmid for the expression and purification of GABARAP. Internal Reference: SMC894DepositorInsertGABARAP (GABARAP Human)
UseTags6xHis-TEVExpressionBacterialMutationEnds with Glycine 116PromoterAvailable SinceSept. 29, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
UseTagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
ePB-PURO-FLAG-METTL3
Plasmid#160252PurposeFor stable integration of FLAG-METTL3 in human cells with trasposaseDepositorInsertmethyltransferase like 3 (METTL3 Human)
UseTagsFLAGExpressionMammalianMutationPromotertight TRE promoterAvailable SinceNov. 18, 2020AvailabilityAcademic Institutions and Nonprofits only -
pFastBac_Dual_GST-TEV-EGFP-TBK1
Plasmid#187830PurposePlasmid for the expression and purification of GST-TEV-EGFP-TBK1 in Spodoptera frugiperda cells (Sf9). Internal reference: SMC1631DepositorInsertTBK1 (TBK1 Human)
UseTagsGST and TEV-mEGFP-GG LinkerExpressionBacterial and InsectMutationPromoterAvailable SinceOct. 20, 2022AvailabilityAcademic Institutions and Nonprofits only -
pT2/GD-IRES-GFP-CTNNB1
Plasmid#192868PurposeCarries a Sleeping Beauty (SB) transposon vector that can be used to deliver an activated human CTNNB1(S33Y) transgene into cells, when a source of SB transposase is also co-introduced.DepositorInsertsluc+
EGFP
CTNNB1
UseTagsExpressionMammalianMutationPromoterAvailable SinceMay 15, 2023AvailabilityAcademic Institutions and Nonprofits only -
pET-Duet1-6xHis-TEV-LC3BGlydelta5C
Plasmid#190237PurposePlasmid for the expression and purification of 6xHis-TEV-LC3BGlydelta5C. Internal reference: SMC893.DepositorAvailable SinceSept. 29, 2022AvailabilityAcademic Institutions and Nonprofits only -
pSL0747 (pDonor_L-MmeI)
Plasmid#130647PurposeEncodes a mini-transposon derived from V. cholerae Tn6677 CAST, with CmR cargo gene. The mutated left end introduces an MmeI recognition site (used for Tn-seq). Total transposon size = 977 bp.DepositorInsertVchCAST donor DNA (L*)
UseCRISPR; TransposonTagsExpressionBacterialMutationTGTTGATG --> TGTTGGAGPromoterAvailable SinceSept. 4, 2019AvailabilityAcademic Institutions and Nonprofits only -
pSL0746 (pDonor_R-MmeI)
Plasmid#130646PurposeEncodes a mini-transposon derived from V. cholerae Tn6677 CAST, with CmR cargo gene. The mutated right end introduces an MmeI recognition site (used for Tn-seq). Total transposon size = 977 bp.DepositorInsertVchCAST donor DNA (R*)
UseCRISPR; TransposonTagsExpressionBacterialMutationTGTTGATA --> TGTTGGAAPromoterAvailable SinceSept. 4, 2019AvailabilityAcademic Institutions and Nonprofits only -
pGEX-4T1_GST-thrombin-TEX264(28-313aa)
Plasmid#227714PurposeExpression of recombinant protein for purificationDepositorAvailable SinceAug. 7, 2025AvailabilityAcademic Institutions and Nonprofits only -
pGEX-4T1_GST-thrombin-FAM134C(250-466aa)
Plasmid#227715PurposeExpression of recombinant protein for purificationDepositorAvailable SinceAug. 7, 2025AvailabilityAcademic Institutions and Nonprofits only -
pHAGE-FKBP-mEGFP-WIPI2
Plasmid#223757PurposeStable expression and inducible recruitment of protein in mammalian cell cultureDepositorAvailable SinceMarch 25, 2025AvailabilityAcademic Institutions and Nonprofits only -
pETDuet1_6xHis-TEV-mCherry-WIPI3
Plasmid#223763PurposeExpression of recombinant protein for purificationDepositorAvailable SinceMarch 25, 2025AvailabilityAcademic Institutions and Nonprofits only -
pHAGE-FKBP-mEGFP-WIPI3
Plasmid#223768PurposeStable expression and inducible recruitment of protein in mammalian cell cultureDepositorAvailable SinceMarch 25, 2025AvailabilityAcademic Institutions and Nonprofits only -
pETDuet1_6xHis-TEV-mCherry-WIPI2d
Plasmid#223725PurposeExpression of recombinant protein for purificationDepositorAvailable SinceMarch 25, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCAG_WIPI2d-TEV-GST
Plasmid#223799PurposeExpression of recombinant protein for purificationDepositorAvailable SinceMarch 25, 2025AvailabilityAcademic Institutions and Nonprofits only