We narrowed to 13,473 results for: Mpl
-
Plasmid#127366PurposeBinary vector for expressing cytosolic TurboID-YFP under the UBQ10 promoter in plantsDepositorInsertTurboID (BirA mutant)
TagsGS linker, NES, V5, and YFPExpressionPlantMutationQ65P, I87V, R118S, E140K, Q141R, S150G, L151P, V1…PromoterArabidopsis UBQ10 promoterAvailable SinceSept. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCA528 IST1 (1-366)
Plasmid#193039PurposeBacterial expression plasmid for full-length IST1 (1-366).DepositorAvailable SinceDec. 9, 2024AvailabilityAcademic Institutions and Nonprofits only -
pCDNA4.TO-ORF39-2xCSTREP
Plasmid#136200PurposeExpresses C-terminally strep tagged Kaposi's Sarcoma Associated Herpesvirus (KSHV) ORF39DepositorInsertORF39
ExpressionMammalianPromoterCMVAvailable SinceApril 22, 2020AvailabilityAcademic Institutions and Nonprofits only -
pSLQ2817 pPB: CAG-PYL1-VPR-IRES-Puro-WPRE-SV40PA PGK-ABI-tagBFP-SpdCas9
Plasmid#84239PurposeExpresses ABA-inducible VPR-Sp dCas9DepositorInsertsABI-tagBFP-Sp dCas9
PYL1-VPR
UseCRISPR and Synthetic Biology; PiggybacTags2xNLS (SV40), ABI, HA tag, IRES-Puro, PYL1, and t…ExpressionMammalianPromoterCAG and PGKAvailable SinceNov. 9, 2016AvailabilityAcademic Institutions and Nonprofits only -
pmiRGLO-GLIS2-201
Plasmid#117331PurposeDual luciferase assay for miRNA-targeted UTRDepositorInsert3' UTR GLIS2-201
UseLuciferaseTagsluciferaseExpressionMammalianPromoterMurine PGK-1Available SinceDec. 14, 2018AvailabilityAcademic Institutions and Nonprofits only -
-
pLV CMV mCherry-DDX1-V5
Plasmid#175162PurposeLentiviral expression of human DDX1-V5DepositorAvailable SinceJan. 18, 2022AvailabilityAcademic Institutions and Nonprofits only -
Flag-V0A
Plasmid#210347PurposeExpresses ATP6V0A in mammalian cellsDepositorAvailable SinceJan. 2, 2024AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
px458_2A_GFP_sgRNA_LTN1
Plasmid#127125DepositorInsertgRNA LTN1 (LTN1 Human)
UseCRISPRAvailable SinceJuly 25, 2019AvailabilityAcademic Institutions and Nonprofits only -
pEVOL-ABK
Plasmid#126035PurposeEfficient expression of tRNA synthetase/tRNA for the incorporation of a photo-cross-linker, 3’-azibutyl-N-carbamoyl-lysine (AbK) into recombinant protein by amber codon (TAG) suppression in E. coli.DepositorInsertstRNA synthetase 1
tRNA synthetase 2
tRNA for TAG codon
ExpressionBacterialMutationL274M, C313A, Y349FPromoteraraBAD promoter, glnS promoter, and proK promoterAvailable SinceSept. 10, 2019AvailabilityAcademic Institutions and Nonprofits only -
qTAG-N-Solo-mScarlet-TUBA1B
Plasmid#207764PurposeDonor template for mScarlet insertion into the N-terminus of the TUBA1B locus for tubulin visualization. To be co-transfected with sgRNA plasmid px330-PITCh-TUBA1B Addgene #207763DepositorInsertTUBA1B Homology Arms flanking a mScarlet Tag (TUBA1B Human)
UseCRISPR; Donor templateExpressionMammalianAvailable SinceNov. 15, 2023AvailabilityIndustry, Academic Institutions, and Nonprofits -
STAT3(Y705F)-TAL-Luc
Plasmid#46933PurposeLuciferase Reporter for mutant STAT3DepositorInsertSTAT3(Y705F) (STAT3 Human)
UseLuciferaseTagsFLAGMutationTyrosine 705 to PhenylalaninePromoterTA LuciferaseAvailable SinceNov. 7, 2013AvailabilityAcademic Institutions and Nonprofits only -
pGGD_MiniTurboID-YFP
Plasmid#222434PurposeGolden Gate / Green Gate module for adding MiniTurboID and YFP as C-terminus of target protein.DepositorInsertMiniTurboID (BirA mutant)
UseGolden gate / green gate compatible cloning vectorTagsLinker and YFPMutationaa1-63 deleted; Q65P, I87V, R118S, E140K, Q141R, …Available SinceJuly 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
qTAG-N-Solo-mStayGold-TUBA1B
Plasmid#227327PurposeDonor template for mStayGold insertion into the N-terminus of the TUBA1B locus. For tubulin visualization. To be co-transfected with sgRNA plasmid px330-PITCh-TUBA1B (Addgene #207763)DepositorInsertTUBA1B Homology Arms flanking a mStayGold Tag (TUBA1B Human)
UseCRISPR; Donor templateExpressionMammalianPromoterPromoterlessAvailable SinceNov. 12, 2024AvailabilityAcademic Institutions and Nonprofits only -
R4pGWB601_UBQ10p-miniTurbo-YFP-NLS
Plasmid#127370PurposeBinary vector for expressing nuclear miniTurbo-YFP under the UBQ10 promoter in plantsDepositorInsertminiTurbo (BirA mutant)
TagsGS linker, NLS, V5, and YFPExpressionPlantMutationaa1-63 deleted; Q65P, I87V, R118S, E140K, Q141R, …PromoterArabidopsis UBQ10 promoterAvailable SinceSept. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pSLQ2821 pPB: CAG-GID1-VPR-IRES-Puro-WPRE PGK-GAI-tagBFP-SpdCas9-ABI
Plasmid#84257PurposeExpresses Sp dCas9 and GA-inducible VPR for OR gate/diametric regulationDepositorInsertsGAI-tagBFP-Sp dCas9-ABI
GID1-VPR
UseCRISPR and Synthetic Biology; PiggybacTags2xNLS (SV40), ABI, GAI, GID1, HA tag, IRES-Puro, …ExpressionMammalianPromoterCAG and PGKAvailable SinceFeb. 22, 2018AvailabilityAcademic Institutions and Nonprofits only -
pAAV-SynI-CreOn-FlpOff-mNaChBac-P2A-EGFP
Plasmid#176280PurposeViral vector for co-expression of NaChBac and EGFP in cells expressing Cre AND NOT Flp driven by the human Synapsin promoter.DepositorInsertmNaChBac-P2A-EGFP
UseAAV and Cre/LoxExpressionMammalianPromoterhuman Synapsin IAvailable SinceJan. 11, 2022AvailabilityAcademic Institutions and Nonprofits only -
pBpaRS3tRNA
Plasmid#197102PurposeTo express the p-benzoylphenylalanine-specific variant of Methanocaldococcus jannaschii TyrRS and its cognate amber suppressor tRNA and allow UAG codon to be translated into p-benzoylphenylalanine.DepositorInsertTyrRS variant, amber suppressor tRNA
ExpressionBacterialMutationGly32, Ser107, Thr158, Ser159, Arg286 (TyrRS)Available SinceJune 15, 2023AvailabilityAcademic Institutions and Nonprofits only -
pGL3 Zscan4 promoter
Plasmid#69249PurposeLuciferase reporter for Dux4 activation of Zscan4 transcriptionDepositorInsertZscan4 (ZSCAN4 Human)
UseLuciferaseMutationThe two single nucleotide mismatches found betwee…PromoterZscan4Available SinceSept. 21, 2015AvailabilityAcademic Institutions and Nonprofits only