We narrowed to 69,065 results for: TOR;
-
Plasmid#188349PurposeLentiviral vector - constitutive expression of an anti-CD19 SNIPR with a ADAM17site, a Notch1-TMD, a Notch1-JMD, and a Gal4VP64 transcriptional factorDepositorInsertPGK_antiCD19_ADAM17site_Notch1-TMD_Notch1-JMD_Gal4VP64
UseLentiviralAvailable SinceMarch 9, 2023AvailabilityAcademic Institutions and Nonprofits only -
pRK5-FLAG-RagB-D163N
Plasmid#42324DepositorAvailable SinceMarch 6, 2013AvailabilityAcademic Institutions and Nonprofits only -
TAL-L1-1.3-VP64
Plasmid#103033PurposePlasmid for IvT reaction with T3. Encodes LINE-1 specific TALE sequence followed by VP64 activatorDepositorInsertTAL-L1-1.3-VP64
UseT3 in vitro transcription for expression in mamma…TagsHA and VP64Available SinceNov. 30, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pMP4518
Plasmid#107778PurposeExpression of EYFPDepositorInsertpLacZ-EYFP in pBBR1-mcs5
TagspLacZ-EYFPExpressionBacterialPromoterpLacZAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
TAL-L1-2.4-VP64
Plasmid#103039PurposePlasmid for IvT reaction with T3. Encodes LINE-1 specific TALE sequence followed by VP64 activatorDepositorInsertTAL-L1-2.4-VP64
UseT3 in vitro transcription for expression in mamma…TagsHA and VP64Available SinceNov. 30, 2017AvailabilityAcademic Institutions and Nonprofits only -
PEP112E
Plasmid#97398Purposebinary construct of mitochondria-targeted mCherry with sfGFP11 tag for plant expressionDepositorInsertmCherry-sfGFP11
TagsMitochondria targetExpressionPlantAvailable SinceSept. 25, 2017AvailabilityAcademic Institutions and Nonprofits only -
-
pENTR-PpU6P-sgRNA-L5L2
Plasmid#113738PurposeGateway entry vector containing attL5 and attL2 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pAV0782
Plasmid#133514PurposeExpression of sfGFP tagged LifeAct probe to monitor actin cytoskeletonDepositorInsertpAde6(PmeI)-p(act1)-LifeAct-sfGFP-terminator(ScADH1)-bsdMX
ExpressionYeastAvailable SinceNov. 12, 2019AvailabilityAcademic Institutions and Nonprofits only -
BcLOV-mCh-EGFR
Plasmid#208274PurposeExpresses BcLOV-EGFR for optogenetic activation of EGFR signaling. Includes an mCherry tag.DepositorInsertBcLOV-mCherry-EGFR
UseLentiviralTagsmCherryPromoterpCMVAvailable SinceJan. 25, 2024AvailabilityAcademic Institutions and Nonprofits only -
pTAJAK-71 (pESC-NatMXsyn-USER)
Plasmid#78232PurposeEmpty vector, for the insertion of gRNA expression cassettes into the vector.DepositorTypeEmpty backboneExpressionYeastAvailable SinceNov. 23, 2016AvailabilityAcademic Institutions and Nonprofits only -
pMX Vav1 uGFP
Plasmid#14557DepositorAvailable SinceApril 12, 2007AvailabilityAcademic Institutions and Nonprofits only -
NLS-GI-VP64-IRES-NLS-GAL4DBD-M13-SmBiT-FKF1
Plasmid#183400PurposeDual expression of GI-VP64 and GAL4DBD-M13-SmBiT-FKF1 in the nucleusDepositorInsertGI-VP64-IRES-GAL4DBD-M13-SmBiT-FKF1
ExpressionMammalianPromoterCMVAvailable SinceMay 26, 2022AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-R4R3
Plasmid#113739PurposeGateway entry vector containing attR4 and attR3 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-L5L4
Plasmid#113741PurposeGateway entry vector containing attL5 and attL4 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-L1R5
Plasmid#113737PurposeGateway entry vector containing attL1 and attR5 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pRc/CMV HA TrkB-T1
Plasmid#39980DepositorInsertTrkB.T1 (Ntrk2 Rat)
TagsBM40 signal sequence and HAExpressionMammalianMutationTrkB.T1 variant; endogenous signal sequence was r…PromoterCMVAvailable SinceMarch 17, 2014AvailabilityAcademic Institutions and Nonprofits only -
PEP111E
Plasmid#97397Purposebinary construct of plastid-targeted mCherry with sfGFP11 tag for plant expressionDepositorInsertmCherry-sfGFP11
TagsPlastid targetExpressionPlantAvailable SinceSept. 25, 2017AvailabilityAcademic Institutions and Nonprofits only -
RCAS(A) mPea3 FL (CT#1119)
Plasmid#13908DepositorInsertPea3 (Etv4 Mouse)
UseRetroviral; Avian expressionAvailable SinceFeb. 16, 2007AvailabilityAcademic Institutions and Nonprofits only