We narrowed to 14,693 results for: flag
-
Plasmid#36958DepositorAvailable SinceJuly 24, 2012AvailabilityAcademic Institutions and Nonprofits only
-
pMSCV-FLAG-hHelios-IRES-GFP
Plasmid#74047Purposeretroviral plasmid for expression of FLAG-tagged human Helios (IKZF2) corresponding to cDNA from NM_001079526.1DepositorInserthuman Helios (IKZF2) (IKZF2 )
UseRetroviralTagsFLAGExpressionMammalianMutationencodes shorter version of human HeliosPromoterpMSCV-LTRsAvailable SinceJune 8, 2016AvailabilityAcademic Institutions and Nonprofits only -
pFA6a-FLAG-APEX2-NES-HIS3
Plasmid#229230PurposeTemplate plasmid for the endogenous tagging with FLAG-APEX2-NAS in yeastDepositorTypeEmpty backboneExpressionYeastAvailable SinceMarch 11, 2025AvailabilityAcademic Institutions and Nonprofits only -
pBacMam2-DiEx-LIC-C-flag_huntingtin_full-length_Q30
Plasmid#111744PurposeBaculovirus transfer vector for expression of huntingtin protein in insect and mammalian cellscells as well as in mammalian cellsDepositorInsertHTT (HTT Human)
UseBaculovirus expressionTagsFLAGExpressionMammalianMutationQ30 (polyQ repeat)PromoterCMV and P10Available SinceAug. 29, 2018AvailabilityAcademic Institutions and Nonprofits only -
pBacMam2-DiEx-LIC-C-flag_huntingtin_full-length_Q54
Plasmid#111727PurposeBaculovirus transfer vector for expression of huntingtin protein in insect and mammalian cellscells as well as in mammalian cellsDepositorInsertHTT (HTT Human)
UseBaculovirus expressionTagsFLAGExpressionMammalianMutationQ54 (polyQ repeat)PromoterCMV and P10Available SinceOct. 31, 2018AvailabilityAcademic Institutions and Nonprofits only -
pAAVLINKv1-pCALM1-Cre-3'-KIF1A-FLAG
Plasmid#244343Purpose3' AAVLINK plasmid for KIF1A expressionDepositorAvailable SinceDec. 2, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1 FLAG-SIV-MAC251-vpx
Plasmid#115842PurposeEncodes codon optimized FLAG tagged SIVMAC251-VpxDepositorInsertSIVMAC251-Vpx
Tags3x-FLAGExpressionMammalianPromoterCMVAvailable SinceJan. 8, 2019AvailabilityAcademic Institutions and Nonprofits only -
pKlab810-bGlobin_3xFLAG-BRCA1(full-length)
Plasmid#249023PurposeThis plasmid expresses the full length BRCA1 sequence with an N-terminal 3xFLAG tagDepositorAvailable SinceJan. 21, 2026AvailabilityAcademic Institutions and Nonprofits only -
p3xFLAG-CMV-14-GINIP-Nluc W139A
Plasmid#223557PurposePlasmid expressing GINIP-Nluc W139A in mammalian cellsDepositorInserthuman GINIP W139A - linker(GGGS) - Nluc
Tags3xFLAGExpressionMammalianMutationW139A mutation in GINIP sequenceAvailable SinceMarch 28, 2025AvailabilityIndustry, Academic Institutions, and Nonprofits -
pGL4.13/GUG, AAA(30)-FFLuc-3XFLAG
Plasmid#127335PurposeExpress 3xFLAG tagged firefly luciferase (FFLuc) from GUG start codon (AUG at codon 30 mutated to AAA)DepositorInsertFirefly luciferase
Tags3xFLAGExpressionMammalianPromoterSV40Available SinceAug. 8, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pLVX-TetOne-Puro-EcSTH-FLAG
Plasmid#218628PurposeThis plasmid contains human codon optimized sequence of EcSTH which is a soluble transhydrogenase from E. coli that can be used to increase NADH/NAD+ ratio in mammalian cells.DepositorInsertEcSTH
UseLentiviral and Synthetic BiologyTagsFLAGExpressionMammalianAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-Flag-RNF168 delta RING
Plasmid#133982Purposemammalian expression vector of Flag tagged RNF168 where the N-terminus of RNF168 has been deleted (including RING domain)DepositorAvailable SinceNov. 4, 2019AvailabilityIndustry, Academic Institutions, and Nonprofits -
pcDNA3-Flag-RNF168 delta MIU1
Plasmid#133978Purposemammalian expression vector of Flag tagged RNF168 where the first motif interacting with ubiquitin (MIU) has been deletedDepositorAvailable SinceNov. 4, 2019AvailabilityIndustry, Academic Institutions, and Nonprofits -
pST1374-NLS-flag-linker-Cas9
Plasmid#44758DepositorInsertHuman codon optimized Cas9
UseCRISPRTags32 amino acid linker, Flag, and NLSExpressionMammalianMutationcodon-optimizedPromoterCMVAvailable SinceApril 24, 2013AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-Flag-RNF168 delta MIU2
Plasmid#133979Purposemammalian expression vector of Flag tagged RNF168 where the second motif interacting with ubiquitin (MIU) has been deletedDepositorAvailable SinceNov. 4, 2019AvailabilityIndustry, Academic Institutions, and Nonprofits -
pWZL Neo Myr Flag FGFR1
Plasmid#20486DepositorAvailable SinceOct. 27, 2009AvailabilityAcademic Institutions and Nonprofits only -
pET30-HPF1-His-Sumo-Flag
Plasmid#111577PurposeExpresses full length HPF1 in E. coliDepositorAvailable SinceJuly 25, 2018AvailabilityAcademic Institutions and Nonprofits only -
pLVX-TetOne-Puro-mitoEcSTH-FLAG
Plasmid#218629PurposeThis plasmid contains human codon optimized sequence of mitoEcSTH which is a soluble transhydrogenase from E. coli that can be used to increase NADH/NAD+ ratio in mammalian cells.DepositorInsertmitoEcSTH
UseLentiviral and Synthetic BiologyTagsFLAG and MTSExpressionMammalianAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
pWZL Neo Myr Flag TBK1
Plasmid#20648DepositorAvailable SinceOct. 27, 2009AvailabilityAcademic Institutions and Nonprofits only