We narrowed to 6,190 results for: ARL
-
Plasmid#209981PurposeContains Level 0 Part: E. coli shuttle part (pMB1_ampR_B0017) for the construction of Level 1 plasmidsDepositorInsertE. coli shuttle part (pMB1_ampR_B0017)
ExpressionBacterialAvailable SinceSept. 13, 2024AvailabilityIndustry, Academic Institutions, and Nonprofits -
pLPE2
Plasmid#209982PurposeContains Level 0 Part: E. coli shuttle part (ampR_B0017) for the construction of Level 1 plasmidsDepositorInsertE. coli shuttle part (ampR_B0017)
ExpressionBacterialAvailable SinceSept. 13, 2024AvailabilityIndustry, Academic Institutions, and Nonprofits -
pLPE3
Plasmid#209985PurposeContains Level 0* Part: E. coli shuttle part (pMB1_cat) for the construction of Level 2 plasmidsDepositorInsertE. coli shuttle part (pMB1_cat)
ExpressionBacterialAvailable SinceSept. 13, 2024AvailabilityIndustry, Academic Institutions, and Nonprofits -
pLPR3
Plasmid#209986PurposeContains Level 0* Part: resistance cassette (ermBL) for the construction of Level 2 plasmidsDepositorInsertresistance cassette (ermBL)
ExpressionBacterialAvailable SinceSept. 13, 2024AvailabilityIndustry, Academic Institutions, and Nonprofits -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
AL12R-HSP70
Plasmid#161010PurposePP7-tagged reporter driven by the Arabidopsis HSP70 promoterDepositorInsertPP7 and H2B-mScarlet
ExpressionPlantAvailable SinceDec. 8, 2020AvailabilityAcademic Institutions and Nonprofits only -
pPIDCB
Plasmid#169899PurposeEmpty dox inducible vector with piggyBac, insulators, and a DTSDepositorTypeEmpty backboneUseAvian expressionExpressionMammalianPromoterDox inducibleAvailable SinceJan. 10, 2024AvailabilityAcademic Institutions and Nonprofits only -
pLenti-Arch-EEQ
Plasmid#45188PurposeArch voltage indicator with double mutations D95Q-D106E (Arch-EEQ), with faster kinetics and greater fluorescence dynamic range than Arch-D95NDepositorInsertenhanced Archaerhodopsin
UseLentiviralTagseYFPExpressionMammalianMutationD95Q, D106EPromoterCamKIIaAvailable SinceJuly 18, 2013AvailabilityAcademic Institutions and Nonprofits only -
sgRNA1_Tet-inducible Luciferase reporter
Plasmid#64161PurposePhotoactivatable transcription system. Mammalian expression of sgRNA1 to target Tet-inducible-luciferase reporter.DepositorInsertsgRNA1 for Tet-inducible Luciferase reporter
UseCRISPRExpressionMammalianPromoterhuman U6Available SinceJune 23, 2015AvailabilityAcademic Institutions and Nonprofits only -
pDONR221-NUDT5
Plasmid#219954PurposeFor gateway cloning of NUDT5DepositorInsertNUDT5 (NUDT5 Human)
Available SinceNov. 4, 2024AvailabilityAcademic Institutions and Nonprofits only -
ORF57 Pr pGL4.16
Plasmid#120378PurposeFirefly luciferase reporter with KSHV ORF57 early gene promoterDepositorInsertORF57 Promoter
UseLuciferasePromoterORF57 PromoterAvailable SinceSept. 20, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-GI-ZFP2
Plasmid#42215PurposeExpresses GI-ZFP2 for light-inducible activation of gene expressionDepositorAvailable SinceJan. 29, 2013AvailabilityAcademic Institutions and Nonprofits only -
pJP118
Plasmid#176494PurposeExpresses Lifeact-mScarlet under control of the Capsaspora EF1 promoter and HygR under control of the Capsaspora actin promoterDepositorInsertLifeact peptide
UseCapsaspora owczarzaki expressionAvailable SinceJune 6, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV MN (eGFP)
Plasmid#89932PurposeExpresses the MN fragment only of the sMTase system for targeted DNA methylation in mammalian cells. Contains a eGFP marker expressed off separate promoter.DepositorInsertMN
TagsHAExpressionMammalianMutationM.SssI residues 2-272 fragmentPromoterCMVAvailable SinceSept. 7, 2017AvailabilityAcademic Institutions and Nonprofits only -
AL13Rb-GAPC2
Plasmid#161009PurposePP7-tagged reporter driven by the Arabidopsis GAPC2 promoterDepositorInsertPP7 and H2B-mScarlet
ExpressionPlantAvailable SinceDec. 8, 2020AvailabilityAcademic Institutions and Nonprofits only -
pY2
Plasmid#218115PurposeActivity reporter backbone with an empty protease cassette (BsaI) under (lexA-box)3PminCYC1 promoter and an empty substrate cassette (BsmBI) under pGAL1 promoter.DepositorTypeEmpty backboneExpressionBacterial and YeastAvailable SinceApril 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-mNox1
Plasmid#58340Purposeexpresses mouse Nox1 in mammalian cellsDepositorAvailable SinceAug. 25, 2014AvailabilityAcademic Institutions and Nonprofits only -
pAG425 GAL Pong TPase L418A, L420A
Plasmid#145795PurposemPing Yeast Transposition AssayDepositorInsertPong TPase L418A, L420A
ExpressionYeastMutationL418A, L420AAvailable SinceJan. 20, 2021AvailabilityIndustry, Academic Institutions, and Nonprofits -
pB80-iLID-mCherry-RAB5
Plasmid#174624PurposeOptogenetic coupling to early endosomes (RAB5) via iLIDDepositorInsertiLID-mCherry-RAB5 (RAB5A Synthetic, Human)
TagsiLID-mCherryExpressionMammalianMutationmCherry: Met1Del; RAB5: Met1DelPromoterChicken beta-actinAvailable SinceNov. 4, 2021AvailabilityAcademic Institutions and Nonprofits only -
pGEX-4T-3-SH3BP1-CTD
Plasmid#136649PurposeExpression of SH3BP1-CTD-GST fusion protein in E. coliDepositorAvailable SinceFeb. 11, 2020AvailabilityAcademic Institutions and Nonprofits only -
pGEX-4T-3-SH3BP1-NTD
Plasmid#136648PurposeExpression of SH3BP1-NTD-GST fusion protein in E. coliDepositorAvailable SinceFeb. 11, 2020AvailabilityAcademic Institutions and Nonprofits only -
pT2ADW_2paRAF
Plasmid#129654PurposeFor generating Tg mice expressing the 2P-activatable RAF system with P2A and full-length RAF1DepositorInsert2paCRY2-Raf1-2A-CIBN-mScarlet-KRasCAAX
ExpressionMammalianPromoterCAGAvailable SinceSept. 12, 2019AvailabilityAcademic Institutions and Nonprofits only -
-
TOPO SV40
Plasmid#68455PurposeTOPO construct expressing SV40 for generation of GMAP-compatible promoterDepositorInsertSimian Virus Early 40 Promoter
UseGmapExpressionBacterialPromoterPlacAvailable SinceFeb. 22, 2016AvailabilityAcademic Institutions and Nonprofits only -
pLV(shRNA)-Puro-U6-CCEPR
Plasmid#108277PurposeshRNA for CCEPR lncRNADepositorAvailable SinceApril 3, 2018AvailabilityAcademic Institutions and Nonprofits only -
-
pGBW-m4092686
Plasmid#153895PurposeBacterial expression plasmid for fragment of SARS-CoV-2 orf1ab 3pUTR to viral genome 3pUTRDepositorInsertfragment of SARS-CoV-2 orf1ab 3pUTR to viral genome 3pUTR (ORF1ab Severe acute respiratory syndrome coronavirus 2)
ExpressionBacterialMutationNearly native encoding;inactivating mutations in …PromoterPromoter | t7 consensus from NEB, G is +1Available SinceJune 12, 2020AvailabilityIndustry, Academic Institutions, and Nonprofits -
Myog'-2A-mCherryNLS-PGK-Purodtk
Plasmid#69547PurposeDonor vector for homologous recombination to insert a 2A-mCherry-NLS cassette in place of the stop codon of myogenin in the mouse genome.DepositorInsertsUseMouse TargetingTags2x nuclear localization signal and PVT1-2A "…MutationSilent V205V mutation in myogenin gene to prevent…Available SinceApril 12, 2019AvailabilityAcademic Institutions and Nonprofits only -
pNCMV 16E6no* delPDZ
Plasmid#47678PurposePDZ-binding motif is deletedDepositorInsertHPV 16 E6no* (E6 HPV, Human)
TagsFLAG and HAExpressionMammalianMutationdel first 7aa and last 6aa, V42L*PromoterCMVAvailable SinceOct. 21, 2013AvailabilityAcademic Institutions and Nonprofits only -
AL13Rb-HsfA2
Plasmid#161012PurposePP7-tagged reporter driven by the Arabidopsis HsfA2 promoterDepositorInsertPP7 and H2B-mScarlet
ExpressionPlantAvailable SinceFeb. 12, 2021AvailabilityAcademic Institutions and Nonprofits only