We narrowed to 27,381 results for: c-myc
-
Plasmid#119843PurposeExpresses mouse Type I procollagen α1 chain (Col1a1) with eGFP replacing exon 2-3 retaining N-propeptide minor triple helix and N-terminal cleavage siteDepositorInsertType I procollagen α1 chain (Col1a1 Mouse)
TagseGFPExpressionMammalianMutationCol1a1 exons 2-3 replaced by fluorescent tagPromoterCMVAvailable sinceApril 2, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-hCdt1-HA
Plasmid#117500PurposeExpresses human Cdt1 fused to HA tagDepositorInsertCdc10-dependent transcript-1 (CDT1 1700 bp, Human)
TagsHAExpressionMammalianMutationwild-typePromoterCMVAvailable sinceJan. 24, 2019AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pcDNA5FRT/TO-Ufd1-Strep-HA
Plasmid#113474PurposeExpression of human Ufd1 with C-terminal strep-HA tagDepositorInsertUfd1 (UFD1 Human)
Tags2xstrep-HAExpressionMammalianMutationwildtype without stop codonPromoterCMVAvailable sinceAug. 14, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pTRIPZ-EGFP:LIMD1
Plasmid#108230PurposeLentiviral vector for Tet-inducible LIMD1 expressionDepositorInsertLIMD1 (LIMD1 Human)
UseLentiviralTagsEGFPExpressionMammalianPromoterTet/ON Minimal CMV promoterAvailable sinceJuly 25, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pSPL
Plasmid#110743PurposePlasmid for the insect cell expression system, donor for plasmid fusions, two promoters, Multiplication Module M, LoxP siteDepositorTypeEmpty backboneExpressionInsectPromoterPolyhedrin and p10 promotersAvailable sinceJune 21, 2018AvailabilityAcademic Institutions and Nonprofits only -
pFLAG_attP
Plasmid#110095PurposeVector for low-level constitutive expression in mycobacteria from the Tet promoter. Lacks the Tet repressor. Contains attP for chromosomal integration. Lacks the integrase and thus remains stably integrated in the absence of antibiotic selection. Contains a C-terminal 3xFLAG to allow detection of expression levels by Western blotting.DepositorTypeEmpty backboneTags3xFLAGExpressionBacterialAvailable sinceJune 20, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
DH10GFP
Bacterial strain#109392PurposeDH10B with a "capacity monitor" inserted in the lambda phage integration site.DepositorBacterial resistanceKanamycinAvailable sinceMay 30, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
GFP-AuroraB kd K106R
Plasmid#108493Purposeexpression of EGFP-AuroraB kinase dead (K106R)DepositorInsertAuroraB (AURKB Human)
TagsEGFPExpressionMammalianMutationKinase death K106APromoterCMVAvailable sinceMay 8, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pEGFP SNAP47
Plasmid#101915PurposeExpresses SNAP47 in mammalian cellsDepositorAvailable sinceMarch 21, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pME GFP-PCNA
Plasmid#105977Purposeentry clone for gateway cloning, cell cycle marker proliferative cell nuclear antigen PCNADepositorAvailable sinceFeb. 6, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
CRY2low-tdTomato
Plasmid#104067PurposeExpresses fusion of CRY2low mutant (CRY2 aa1-491 R489E A491D) with tdTomatoDepositorInsertCRY2low-tdTomato
ExpressionMammalianMutationCRY2 aa 1-491 truncation, R489E A491DPromoterCMVAvailable sinceJan. 2, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
ptagRFP-MS2coatProtein
Plasmid#103831PurposeLive cell reader for MS2 loop RNA productionDepositorInsertMS2 coat protein (MCP) (cp )
TagstagRFPExpressionMammalianMutationMCP: nt 202-240 are missing (13 aa), C242G (A81G)…PromoterCMVAvailable sinceDec. 4, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
sg14x(MS2) MUC4.1
Plasmid#101153PurposegRNA with 14 MCP binding siteDepositorInsertMUC4 (MUC4 Human)
UseCRISPR and LentiviralAvailable sinceNov. 9, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
stabilized HP35 tension sensor module
Plasmid#101251PurposeExpresses the stabilized HP35-based tension sensor module. The biosensor allows force measurements at 9-11 pN.DepositorInsertYPet(short)-HP35st-mCherry
UseRetroviralTagsHis-tag and cysteineExpressionMammalianPromoterCMVAvailable sinceNov. 2, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
SQ171fg/pCSacB
Plasmid#69344PurposeSQ171 fast growing strain supported by pCSacB plasmidDepositorInsertpCSacB
Available sinceOct. 25, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable sinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
p7052 pHAGE-P-CMVt-N-HA-GAW-AURKB
Plasmid#100142PurposeExpreses AURKBDepositorAvailable sinceOct. 3, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
CIB-VP64 (B1016)
Plasmid#92037PurposeExpresses CIB1 (Full-length, with endogenous NLS) fused to VP64 activation domain (4xVP16 inserts)DepositorInsertCIB1-VP64 (CIB1 Mustard Weed)
TagsFusion of plant CIB1 with VP64 activation domain.…ExpressionMammalianPromoterCMVAvailable sinceJuly 25, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
CRY-Gal∆DD (B1013)
Plasmid#92035PurposeExpresses CRY2 (full-length, with endogenous NLS) fused to Gal4 (aa1-65 of Gal4BD), downstream of mCherry-IRESDepositorInsertCRY2 (CRY2 Mustard Weed)
ExpressionMammalianMutationFusion of plant CRY2 to Gal4 binding domain (AA1-…Available sinceJuly 25, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pDONR223_POU2F2_WT
Plasmid#81873PurposeGateway Donor vector containing POU2F2 , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits only