We narrowed to 68,416 results for: TOR;
-
Plasmid#44037DepositorAvailable SinceApril 23, 2013AvailabilityAcademic Institutions and Nonprofits only
-
pCCl-MCS_miniCMV_TagBFP
Plasmid#134986PurposeThe plasmid includes a TagBFP gene driven by a minimal CMV promoter. Cis-regulatory elements can be cloned into the single EcoRV site. This plasmid can be used for generating a lentiviral vectorDepositorInsertTagBFP
UseLentiviralPromoterminCMVAvailable SinceJuly 15, 2020AvailabilityAcademic Institutions and Nonprofits only -
pFA6a-GST-His3MX6
Plasmid#41604DepositorInsertHis3
UseYeast genomic targetingTagsA. gossypii translation elongation factor 1a gene…Available SinceDec. 10, 2012AvailabilityAcademic Institutions and Nonprofits only -
pLKO.1 RagA shRNA #2
Plasmid#30320DepositorAvailable SinceJune 2, 2011AvailabilityAcademic Institutions and Nonprofits only -
pMpGWB113
Plasmid#68567PurposeGateway binary vector designed for transgenic research with Marchantia polymorpha as well as other plantsDepositorTypeEmpty backboneTagsGlucocorticoid receptor (GR)ExpressionPlantPromoterMpEF1alpha promoterAvailable SinceJune 24, 2016AvailabilityAcademic Institutions and Nonprofits only -
pMZ3012
Plasmid#204400PurposeA C4-HSL sensor for B. subtilis on a shuttle vector for B. subtilis and E. coli.DepositorInsertsUseSynthetic BiologyPromoterPftsH and Synthetic promoter PRhl0L0L12Available SinceDec. 12, 2023AvailabilityAcademic Institutions and Nonprofits only -
pRN3P_T3_ABEmax_IVT
Plasmid#171761PurposePlasmid to be used as DNA template for in-vitro RNA transcription of the ABEmax base editor (A to G) by T3 RNA polymeraseDepositorInsertABEmax
UseVector for in-vitro transcriptionPromoterT3 promoterAvailable SinceDec. 1, 2021AvailabilityAcademic Institutions and Nonprofits only -
pMpGWB134
Plasmid#68588PurposeGateway binary vector designed for transgenic research with Marchantia polymorpha as well as other plantsDepositorTypeEmpty backboneTagsGlucocorticoid receptor (GR)ExpressionPlantPromoterMpHSP17.8A1 promoterAvailable SinceJuly 13, 2016AvailabilityAcademic Institutions and Nonprofits only -
pMpGWB334
Plasmid#68662PurposeGateway binary vector designed for transgenic research with Marchantia polymorpha as well as other plantsDepositorTypeEmpty backboneTagsGlucocorticoid receptor (GR)ExpressionPlantPromoterMpHSP17.8A1 promoterAvailable SinceJune 24, 2016AvailabilityAcademic Institutions and Nonprofits only -
Flag pLJM1 RagD 77L
Plasmid#19317DepositorInsertRas-related GTP binding D (RRAGD Human)
UseLentiviralTagsFlagExpressionMammalianMutationS77LAvailable SinceSept. 15, 2008AvailabilityAcademic Institutions and Nonprofits only -
pGEX-6p-1 Sesn2
Plasmid#61873Purposebacterial expression of a GST-Sesn2 (mouse)DepositorAvailable SinceJan. 20, 2015AvailabilityAcademic Institutions and Nonprofits only -
pRN3P_T3_BE4_IVT
Plasmid#171762PurposePlasmid to be used as DNA template for in-vitro RNA transcription of the BE4 base editor (C to T) by T3 RNA polymeraseDepositorInsertBE4
UseVector for in-vitro transcriptionPromoterT3 promoterAvailable SinceDec. 1, 2021AvailabilityAcademic Institutions and Nonprofits only -
pAV0620
Plasmid#133506PurposeExpression of eGFP tagged PCNA to monitor DNA replicationDepositorInsertpUra4(AfeI)-p(pcn1)-eGFP-pcn1-terminator(nmt1)-natMX
ExpressionYeastAvailable SinceNov. 19, 2019AvailabilityAcademic Institutions and Nonprofits only -
PEP110E
Plasmid#97396Purposebinary construct of nuclear mCherry with sfGFP11 tag for plant expressionDepositorInsertmCherry-sfGFP11
TagsNucleus targetExpressionPlantAvailable SinceSept. 25, 2017AvailabilityAcademic Institutions and Nonprofits only -
pMT3-FLAG-KLF3
Plasmid#49102PurposeExpresses KLF3 in mammalian cellsDepositorInsertKrüppel-Like Factor 3(KLF3)
TagsFLAGExpressionMammalianAvailable SinceNov. 8, 2013AvailabilityAcademic Institutions and Nonprofits only -
pMOD_A-CmYLCV-dCas9-24XGP41
Plasmid#202009PurposeMoclo level 1 - Module A, Promoter: CmYLCV, Gene: dCas9-24XGP41, Terminator: HSPDepositorInsertdCas9-24XGP41
UseSynthetic Biology; Moclo level 1 vectorTagsGS linkersPromoterCmYLCVAvailable SinceJuly 31, 2023AvailabilityAcademic Institutions and Nonprofits only -
pMP4657
Plasmid#107773PurposeExpression of EGFPDepositorInsertpLacZ-EGFP in pME6010
TagspLacZ-EGFPExpressionBacterialPromoterpLacZAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
pHR_PGK_ALPPL2 synNotch
Plasmid#188376PurposeLentiviral vector - constitutive expression of an anti-ALPPL2 synNotch with a Gal4VP64 transcriptional factorDepositorInsertPGK_antiALPPL2_synNotch_Gal4VP64
UseLentiviralAvailable SinceMarch 9, 2023AvailabilityAcademic Institutions and Nonprofits only -
pEN_TmiR_Luc-A
Plasmid#25760PurposeEntry vector withTRE promoter driving control Luciferase miR30-based shRNA.DepositorInsertLuciferase miR-shRNA
UseEntry vectorAvailable SinceJuly 1, 2010AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-L1L2
Plasmid#113735PurposeGateway entry vector containing attL1 and attL2 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pRK5-FLAG-RagC-D181N
Plasmid#42325DepositorAvailable SinceMarch 6, 2013AvailabilityAcademic Institutions and Nonprofits only -
pHR_PGK_SNIPR_ADAM17 site
Plasmid#188349PurposeLentiviral vector - constitutive expression of an anti-CD19 SNIPR with a ADAM17site, a Notch1-TMD, a Notch1-JMD, and a Gal4VP64 transcriptional factorDepositorInsertPGK_antiCD19_ADAM17site_Notch1-TMD_Notch1-JMD_Gal4VP64
UseLentiviralAvailable SinceMarch 9, 2023AvailabilityAcademic Institutions and Nonprofits only -
pAV0785
Plasmid#133507PurposeExpression of mCherry tagged PCNA to monitor DNA replicationDepositorInsertpUra4(AfeI)-p(pcn1)-mCherry-pcn1-terminator(nmt1)-natMX
ExpressionYeastAvailable SinceNov. 19, 2019AvailabilityAcademic Institutions and Nonprofits only -
pOPS0750
Plasmid#115511PurposeReporter plasmid suitable for experiments in environments where there is no antibiotic selection present. Constitutive promoter pNeo expressing gusA.DepositorInsertgusA pOGG083, T-pharma pOGG003 assembled in pOGG026
ExpressionBacterialMutationDomesticated for Golden Gate cloningPromoterConstitutive promoter pNeo pOGG001Available SinceJan. 16, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCORE-Kp53
Plasmid#72241PurposeContains the CORE cassette with KanMX4 and human p53 gene markersDepositorAvailable SinceJan. 28, 2016AvailabilityAcademic Institutions and Nonprofits only -
pRK5-FLAG-RagB-D163N
Plasmid#42324DepositorAvailable SinceMarch 6, 2013AvailabilityAcademic Institutions and Nonprofits only -
TAL-L1-1.3-VP64
Plasmid#103033PurposePlasmid for IvT reaction with T3. Encodes LINE-1 specific TALE sequence followed by VP64 activatorDepositorInsertTAL-L1-1.3-VP64
UseT3 in vitro transcription for expression in mamma…TagsHA and VP64Available SinceNov. 30, 2017AvailabilityAcademic Institutions and Nonprofits only -
pEN_TTGmiRc2
Plasmid#25753PurposeEntry vector for cloning miR30-based shRNA driven by TRE-tight promoter with GFP coexpression.DepositorTypeEmpty backboneUseEntry vectorTagsGFPAvailable SinceJuly 1, 2010AvailabilityAcademic Institutions and Nonprofits only -
pMP4518
Plasmid#107778PurposeExpression of EYFPDepositorInsertpLacZ-EYFP in pBBR1-mcs5
TagspLacZ-EYFPExpressionBacterialPromoterpLacZAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
-
pENTR-PpU6P-sgRNA-L5L2
Plasmid#113738PurposeGateway entry vector containing attL5 and attL2 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
TAL-L1-2.4-VP64
Plasmid#103039PurposePlasmid for IvT reaction with T3. Encodes LINE-1 specific TALE sequence followed by VP64 activatorDepositorInsertTAL-L1-2.4-VP64
UseT3 in vitro transcription for expression in mamma…TagsHA and VP64Available SinceNov. 30, 2017AvailabilityAcademic Institutions and Nonprofits only -
PEP112E
Plasmid#97398Purposebinary construct of mitochondria-targeted mCherry with sfGFP11 tag for plant expressionDepositorInsertmCherry-sfGFP11
TagsMitochondria targetExpressionPlantAvailable SinceSept. 25, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAV0782
Plasmid#133514PurposeExpression of sfGFP tagged LifeAct probe to monitor actin cytoskeletonDepositorInsertpAde6(PmeI)-p(act1)-LifeAct-sfGFP-terminator(ScADH1)-bsdMX
ExpressionYeastAvailable SinceNov. 12, 2019AvailabilityAcademic Institutions and Nonprofits only -
BcLOV-mCh-EGFR
Plasmid#208274PurposeExpresses BcLOV-EGFR for optogenetic activation of EGFR signaling. Includes an mCherry tag.DepositorInsertBcLOV-mCherry-EGFR
UseLentiviralTagsmCherryPromoterpCMVAvailable SinceJan. 25, 2024AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-R4R3
Plasmid#113739PurposeGateway entry vector containing attR4 and attR3 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-L5L4
Plasmid#113741PurposeGateway entry vector containing attL5 and attL4 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-L1R5
Plasmid#113737PurposeGateway entry vector containing attL1 and attR5 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pTAJAK-71 (pESC-NatMXsyn-USER)
Plasmid#78232PurposeEmpty vector, for the insertion of gRNA expression cassettes into the vector.DepositorTypeEmpty backboneExpressionYeastAvailable SinceNov. 23, 2016AvailabilityAcademic Institutions and Nonprofits only