We narrowed to 30,916 results for: TRO
-
Plasmid#110358PurposeMammalian retroviral expression of Tetracycline repressor with β-globin intron for doxycycline inducible systemsDepositorInsertTetracycline repressor
UseRetroviralExpressionMammalianPromotergag truncatedAvailable SinceJune 22, 2018AvailabilityAcademic Institutions and Nonprofits only -
pDY1623 NOLC1 sgRNA 2
Plasmid#234834PurposesgRNA 2 for NOLC1 STITCHR insertionDepositorInsertNOLC1 sgRNA (NOLC1 Human)
UseCRISPRAvailable SinceApril 10, 2025AvailabilityAcademic Institutions and Nonprofits only -
Endosome-targeted optoPLD
Plasmid#140056PurposeEncodes CRY2-mCherry-PLD-P2A-CIBN-2xFYVE for mammalian expressionDepositorInsertPhospholipase D
Tags2xFYVE, CIBN, CRY2, P2A, and mCherryExpressionMammalianAvailable SinceMarch 23, 2020AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Nterm
Plasmid#102644PurposeEpitope tag n-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pBabe NEO mRFP1
Plasmid#98397PurposeRetroviral vector for constitutive mRFP1 expressionDepositorInsertmRFP1
UseRetroviralExpressionMammalianAvailable SinceSept. 26, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCDNA3-human C-MYC-V394D
Plasmid#74162PurposeMammalian expression of human cMyc VD mutantDepositorAvailable SinceApril 11, 2016AvailabilityAcademic Institutions and Nonprofits only -
p221k-erTq2CFP
Plasmid#71264PurposeEntry clone containing ER-localized Turqoise2. Can be used to construct transcriptional reporters. For use in plants and compatible with the MultiSite Gateway system.DepositorInsertTq2CFP
UseGateway CloningTagsER retention signal HDEL and signal peptide (ER)…Available SinceJan. 14, 2016AvailabilityAcademic Institutions and Nonprofits only -
-
pBAD/HisD-LSSmKate1
Plasmid#31908DepositorInsertLSSmKate1
TagsHISExpressionBacterialMutationK69Y/P131T/S148G/M167E/T183S/M196V compared to mK…Available SinceSept. 13, 2011AvailabilityAcademic Institutions and Nonprofits only -
F3/-2.5CAT
Plasmid#25425DepositorAvailable SinceAug. 2, 2010AvailabilityAcademic Institutions and Nonprofits only -
pDONR223-ULK4
Plasmid#23849DepositorInsertULK4 (ULK4 Human)
UseGateway CloningAvailable SinceJuly 30, 2010AvailabilityAcademic Institutions and Nonprofits only -
pAAV_hSyn-PdCO-EGFP-WPRE (AAV1)
Viral Prep#198513-AAV1PurposeReady-to-use AAV1 particles produced from pAAV_hSyn-PdCO-EGFP-WPRE (#198513). In addition to the viral particles, you will also receive purified pAAV_hSyn-PdCO-EGFP-WPRE plasmid DNA. Synapsin-driven expression of the optimized opsin PdCO in frame with EGFP. These AAV preparations are suitable purity for injection into animals.DepositorPromoterSynTagsEGFPAvailable SinceApril 10, 2024AvailabilityAcademic Institutions and Nonprofits only -
pLV[Exp]-Neo-EF1A>Tet3G
Plasmid#184379PurposeThe Tet3G gene is expressed under a constitutive EF1-alpha promoter. This protein binds a TRE3G promoter to activate gene transcription only in the presence of tetracycline or its analogs (e.g. doxycycline)DepositorInsertTet3G
UseLentiviralAvailable SinceMay 23, 2022AvailabilityAcademic Institutions and Nonprofits only -
pDN43
Plasmid#61346PurposemCherry fused to LINuS, a light-inducible nuclear localization signal (biNLS11/PKIt NES)DepositorInsertmCherry
TagsGS linker-AsLov2-biNLS11 and PKIt NESExpressionMammalianPromoterCMVAvailable SinceMay 13, 2015AvailabilityAcademic Institutions and Nonprofits only -
pINS-Blast
Plasmid#31388DepositorInsertbsd
UseCre/LoxAvailable SinceSept. 13, 2012AvailabilityAcademic Institutions and Nonprofits only -
pSMT3_SRSF1
Plasmid#201056PurposeExpress sumo-tagged human SRSF1DepositorAvailable SinceAug. 3, 2023AvailabilityAcademic Institutions and Nonprofits only -
YFVdelNS1-Cre
Plasmid#179952PurposepCCI vector encoding YFV-17D lacking nonstructural protein 1 (NS1) but with CreDepositorInsertYFV-17D lacking nonstructural protein 1 (NS1), but with Cre
UseTransneuronal tracingPromoterSP6Available SinceFeb. 11, 2022AvailabilityAcademic Institutions and Nonprofits only -
HA-BICD2(1-500)-FRB
Plasmid#174648PurposeRapalog-inducible coupling to dynein adaptor BICD2DepositorInsertHA-BICD2(1-500)-FRB
TagsFRB and HAExpressionMammalianMutationmmBICD2(aa1-500): Lys213GluPromoterChicken beta-actinAvailable SinceNov. 9, 2021AvailabilityAcademic Institutions and Nonprofits only -
pLenti HsATP13A2 WT
Plasmid#171485Purposetransfer plasmid for lentiviral vector production expressing Hs ATP13A2 WTDepositorAvailable SinceJuly 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pAAV hSyn FLEx-FRT Kir2.1-2A-GFP
Plasmid#161577PurposeExpression of Kir2.1-2A-GFP in a Flp-dependent fashionDepositorAvailable SinceNov. 20, 2020AvailabilityAcademic Institutions and Nonprofits only