We narrowed to 3,600 results for: gla
-
Plasmid#162563PurposeInactivation of Aurli_150841 (crtIBY) in Aurantiochytrium limacinum MYA-1381 with zeocin resistance driven by native GAPDH promoter/termiator system.DepositorInsertshble
UseUnspecifiedPromoterGAPDHAvailable SinceMay 28, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcihygroflagsynhDAT
Plasmid#19990DepositorAvailable SinceSept. 22, 2009AvailabilityAcademic Institutions and Nonprofits only -
GEARBOCS-SPARCL1-GeneTRAP
Plasmid#218184PurposeTo KO and genetrap mouse Hevin simultaneouslyDepositorInsertsgRNA (Sparcl1 Mouse)
UseAAV and CRISPRAvailable SinceAug. 23, 2024AvailabilityAcademic Institutions and Nonprofits only -
GEARBOCS-SPARCL1-N-HATag
Plasmid#218185PurposeTo tag Hevin with HA at the N-terminalDepositorInsertsgRNA (Sparcl1 Mouse)
UseAAV and CRISPRAvailable SinceAug. 23, 2024AvailabilityAcademic Institutions and Nonprofits only -
GEARBOCS-SPARCL1 KO
Plasmid#218182PurposeTo KO Hevin in astrocytesDepositorInsertsgRNA (Sparcl1 Mouse)
UseAAV and CRISPRAvailable SinceAug. 23, 2024AvailabilityAcademic Institutions and Nonprofits only -
Myc tag S16-A PTB
Plasmid#23025DepositorAvailable SinceJune 4, 2010AvailabilityAcademic Institutions and Nonprofits only -
DVK_AF
Plasmid#66068PurposeMoClo Destination Vector: (based on pSB1K3) [A:LacZa:F]DepositorTypeEmpty backboneUseSynthetic Biology; Destination vectorAvailable SinceJan. 21, 2016AvailabilityAcademic Institutions and Nonprofits only -
MECP2 - R133C in pENTR
Plasmid#216594Purposegateway cloning donor vector containing MECP2 ASD mutationDepositorAvailable SinceMarch 27, 2024AvailabilityAcademic Institutions and Nonprofits only -
pCS4
Plasmid#55751PurposeProduces one half (alpha) of aminoglycoside phosphotransferase (3′)-IIa when in the presence of T7 RNA Polymerase.DepositorInsertKanR
ExpressionBacterialMutationResidues 1-59 of KanRPromoterT7-lacAvailable SinceJuly 15, 2014AvailabilityAcademic Institutions and Nonprofits only -
Cdk3-DN-HA
Plasmid#1880DepositorInsertCdk3 (CDK3 Human)
TagsHAExpressionMammalianMutationDominant negative, D to N in conserved KLAD*FGLAR…Available SinceJan. 24, 2006AvailabilityAcademic Institutions and Nonprofits only -
pLKO.1-scrCdh2.1 GFP
Plasmid#209100PurposeGFP expressing scramble of shRNA targeting Cdh2DepositorInsertscrCdh2.1
Available SinceDec. 8, 2023AvailabilityAcademic Institutions and Nonprofits only -
pNRB143
Plasmid#36452DepositorAvailable SinceAug. 29, 2012AvailabilityAcademic Institutions and Nonprofits only -
pHPK1212
Plasmid#8834DepositorInserttobacco vein mottling virus protease, catalytic domain
TagsMBPExpressionBacterialAvailable SinceMay 24, 2006AvailabilityAcademic Institutions and Nonprofits only -
pSR26-2
Plasmid#104335PurposeExpresses ompR from a TetR reuglated promoter under inducible ATC control.DepositorAvailable SinceApril 17, 2018AvailabilityAcademic Institutions and Nonprofits only -
EC.SurA.TYB1.a172-274.wt
Plasmid#15934DepositorInsertPeptidyl prolyl isomerase domain 1 of SurA (surA E. coli)
TagsinteinExpressionBacterialMutationwild typeAvailable SinceNov. 9, 2007AvailabilityAcademic Institutions and Nonprofits only -
NmMetQ WT
Plasmid#129647PurposeExpresses the mature metQ gene from Neisseria meningitides, without the signal sequenceDepositorInsertmetQ Gene
Tags10x Histidine Tag, Enterokinase, and pelB signal …ExpressionBacterialPromoterT7 PromoterAvailable SinceSept. 3, 2019AvailabilityAcademic Institutions and Nonprofits only -
-
pTH1-SaSrtA-KA
Plasmid#64981PurposeExpresses the E105K/E108A mutant of Staphylococcus aureus sortase A in E. coliDepositorInsertsortase A
TagsHis6 tag, Mxe GyrA intein, and chitin-binding pro…ExpressionBacterialMutationdeleted amino acids 1-59, E105K, E108AAvailable SinceJune 5, 2015AvailabilityAcademic Institutions and Nonprofits only -
pTXG-hTDG-K330A
Plasmid#52282PurposeBacterial expression of human TDG-K330A C-terminally fused to GyrA intein and GSTDepositorInserthTDG (TDG Human)
TagsGyrA-intein-GSTExpressionBacterialMutationK330A, SUMO acceptor site mutationPromoterT7Available SinceJuly 10, 2014AvailabilityAcademic Institutions and Nonprofits only