We narrowed to 12,952 results for: sequence
-
Plasmid#71999PurposeExpresses the extracellular region of the PlexinA4 protein, C-terminally fused to alkaline phosphatase + 6X histidine tag.DepositorAvailable SinceJan. 25, 2016AvailabilityAcademic Institutions and Nonprofits only
-
pDONR-U6gRNA-PGKpuro2APDGFB
Plasmid#136409PurposeDonor vector for gRNA subcloning. Required for gRNA cloning into the RCAS-DV. Also constitutively expresses PDGFB.DepositorTypeEmpty backboneUseCRISPRTagsExpressionMutationBbsI restriction site in the PDGFB sequence (Glu1…PromoterU6, PDKAvailable SinceAug. 10, 2020AvailabilityAcademic Institutions and Nonprofits only -
pPICZ-pOst1-pro-alphaf(MUT1)-E2-Crimson
Plasmid#117662PurposeTest intracellular localisation of E2-Crimson and study the secretion efficiencyDepositorInsertpOst1-pro-af(MUT1)-E2-Crimson
UseTagsExpressionYeastMutationThis plasmid encodes the fluorescent protein E2-C…PromoterpAOX1Available SinceDec. 12, 2018AvailabilityAcademic Institutions and Nonprofits only -
pTAMAHISTEV_PfeAQ482A
Plasmid#128945Purposeexpresses Q482A mutant of PfeA in E. coliDepositorInsertferric enterobactin receptor
UseTagsTEV protease cleavable 7xHis and TamAExpressionBacterialMutationSignal peptide sequence has been removed (1-75), …PromoterT7Available SinceAug. 26, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-MS2-HA-HsNot4_AA
Plasmid#148255PurposeMammalian Expression of HsNot4DepositorInsertHsNot4 (CNOT4 Human)
UseTagsExpressionMammalianMutationone silent mutation compared to the sequence give…PromoterAvailable SinceNov. 11, 2020AvailabilityAcademic Institutions and Nonprofits only -
pUF1-dCas9-Sir2a
Plasmid#122510PurposeCombining with the specific sgRNA sequence to repress the Plasmodium falciparum endogenous gene transcription, through the decreasing of H3K9 acetylation.DepositorInsertdCas9-Sir2a
UseCRISPRTags3*FLAGExpressionMutationdCas9(D10A,H840A)PromoterPfHsp86Available SinceJune 19, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCS2-FLAG-hEcto/Tif1g-CAmut
Plasmid#20903DepositorInsertEctodermin (TRIM33 Human)
UseTagsFLAGExpressionMammalianMutationPoint mutagenesis of C125 and C128 to Alanine (RI…PromoterAvailable SinceMay 15, 2009AvailabilityAcademic Institutions and Nonprofits only -
gRNA_DNMT3a-T2
Plasmid#41822PurposeExpresses a guide RNA (gRNA) to target DNMT3a (T2 target sequence) for genome engineeringDepositorAvailable SinceJan. 11, 2013AvailabilityAcademic Institutions and Nonprofits only -
Unc5b.a-Fc-His
Plasmid#72178PurposeExpresses the extracellular region of the Unc5B, isoform a protein, C-terminally fused to the Fc region of human IgG1 + 6X histidine tag.DepositorAvailable SinceFeb. 11, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
UseTagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pFastBacDual with LFn + Fla
Plasmid#84866PurposeBaculovirus Expression of LFn -Fla fusion. The LFn domain acts as a signal sequence that targets proteins for cytosolic translocation via the co-administered protective antigen (PA) channel proteinDepositorInsertsLFn
Fla
UseBaculovirusTagsExpressionInsectMutationPromoterPolyhedrinAvailable SinceNov. 10, 2016AvailabilityAcademic Institutions and Nonprofits only -
Sema6c-Fc-His
Plasmid#72167PurposeExpresses the extracellular region of the Sema6C protein, C-terminally fused to the Fc region of human IgG1 + 6X histidine tag.DepositorAvailable SinceFeb. 26, 2016AvailabilityAcademic Institutions and Nonprofits only -
pMDC32B-AtTAS1c-D2-B/c
Plasmid#137884PurposePlant expression vector (2x35S) for direct cloning of synthetic trans-acting siRNAs into Arabidopsis thaliana TAS1c precursor into position downstream 3'D1[+]DepositorInsertAtTAS1c-D2-B/c
UseTagsExpressionPlantMutationA. thaliana TAS1c precursor sequence including a …Promoter2x35SAvailable SinceMay 14, 2020AvailabilityAcademic Institutions and Nonprofits only -
scADGFP
Plasmid#114434PurposeEpilepsy promoter enhanced with Arc elements driving GFP with SV40E polyADepositorInsertGreen fluorescent protein
UseAAVTagsER export sequence FCYENEVExpressionMammalianMutationPromoterNovel synthetic activity-dependent promoterAvailable SinceSept. 25, 2023AvailabilityAcademic Institutions and Nonprofits only -
MTRAP-bio
Plasmid#47746PurposeExpresses enzymatically monobiotinylated full-length MTRAP ectodomain with no N-linked glycans upon cotransfection with BirA in mammalian cells. Contains a C-terminal rat Cd4 d3+4 tag.DepositorInsertCodon-optimised MTRAP
UseTagsenzymatic biotinylation sequence and rat Cd4 d3+4ExpressionMammalianMutationExogenous signal peptide of mouse origin, changed…PromoterCMVAvailable SinceFeb. 4, 2014AvailabilityAcademic Institutions and Nonprofits only -
MSP10-bio
Plasmid#47719PurposeExpresses enzymatically monobiotinylated full-length MSP10 ectodomain with no N-linked glycans upon cotransfection with BirA in mammalian cells. Contains a C-terminal rat Cd4 d3+4 tag.DepositorInsertCodon-optimised MSP10
UseTagsenzymatic biotinylation sequence and rat Cd4 d3+4ExpressionMammalianMutationExogenous signal peptide of mouse origin, changed…PromoterCMVAvailable SinceFeb. 4, 2014AvailabilityAcademic Institutions and Nonprofits only -
pAAV Syn ChR E90R-D156N-T159C 2A tDimer
Plasmid#52494PurposeHistorical plasmid. For inhibition of neuronal activity, note that Addgene Plasmid #66709 is a light-gated chloride channel with improved anion selectivity (iChloC)DepositorInsertsChannelrhodopsin-2
red fluorescent protein
UseAAVTagsExpressionMammalianMutationE90R, D156N, T159CPromoterhuman synapsin-1 and ribosomal skip sequenceAvailable SinceApril 7, 2014AvailabilityAcademic Institutions and Nonprofits only -
Neo1.a-AP-His
Plasmid#71963PurposeExpresses the extracellular region of the Neogenin 1, isoform a protein, C-terminally fused to alkaline phosphatase + 6X histidine tag.DepositorAvailable SinceFeb. 2, 2016AvailabilityAcademic Institutions and Nonprofits only -
tet-pLKO shMKP1.v1 puro
Plasmid#87790PurposeExpresses an inducible short hairpin targeting human MKP1 sequenceDepositorAvailable SinceMarch 27, 2017AvailabilityAcademic Institutions and Nonprofits only -
Igfbp1-promoter/pGL3
Plasmid#12146DepositorInsertIGFBP1 promoter (Igfbp1 Rat)
UseLuciferaseTagsLuciferaseExpressionMammalianMutationContains the canonical insulin response sequence …PromoterAvailable SinceAug. 2, 2007AvailabilityAcademic Institutions and Nonprofits only -
mCerulean3-Golgi-7
Plasmid#55420PurposeLocalization: GalT Targeting Sequence, Excitation: 433, Emission: 475DepositorInsertGolgi (B4GALT1 Human)
UseTagsmCerulean3ExpressionMammalianMutationaa 1-82 of NM_001497.3PromoterCMVAvailable SinceOct. 10, 2014AvailabilityAcademic Institutions and Nonprofits only -
Human HOXA9-MSCV-short
Plasmid#20978DepositorInsertHOXA9 (HOXA9 Human)
UseRetroviralTagsFlagExpressionMammalianMutationMissing amino acid #1. Missing 3'UTR. Coding…PromoterAvailable SinceAug. 14, 2009AvailabilityAcademic Institutions and Nonprofits only -
pAAV CAG ChR2 E123T T159C 2A tDimer
Plasmid#85399PurposeHigh efficiency channelrhodopsin with cytomegalovirus enhancer fused to chicken β-actin (CAG) promoterDepositorInsertsChannelrhodopsin-2
red fluorescent protein
UseAAVTagsExpressionMammalianMutationE123T , T159CPromoterCAG and ribosomal skip sequence 2AAvailable SinceJan. 2, 2018AvailabilityAcademic Institutions and Nonprofits only -
LITE2.0 pAAV_hSyn_NLS(alpha-imp)-CRY2PHR-NLS-VP64_2A_GFP_WPRE_bGHpA
Plasmid#47455PurposeLITE2.0 CRY2PHR-VP64. Changes from LITE1.0: N-terminal alpha-importin nuclear localization sequence. Synapsin promoter for neuronal expression.DepositorInsertNLS(alpha-imp)-CRY2PHR-NLS-VP64
UseAAVTags2A_GFPExpressionMammalianMutationPromoterhSyn human synapsin (mammalian neuronal expressio…Available SinceOct. 15, 2013AvailabilityAcademic Institutions and Nonprofits only -
VVT1
Plasmid#65779PurposeThe Joung Lab recommends using BPK2660 (Addgene plasmid 70709) instead of VVT1 as guide RNAs cloned into BPK2660 are more effective than this plasmid. Human expression plasmid for S. aureus Cas9 sgRNADepositorInsertSaCas9 gRNA backbone, without spacer sequence
UseCRISPRTagsExpressionMammalianMutationPromoterU6Available SinceJune 22, 2015AvailabilityAcademic Institutions and Nonprofits only -
pH7WG2B-OsMIR390-B/c
Plasmid#61465PurposePlant expression vector (OsUBI promoter) for direct cloning of artificial microRNAs into rice MIR390 precursor. To use for expressing amiRNAs in monocots.DepositorInsertOsMIR390-B/c
UseTagsExpressionPlantMutationO. sativa MIR390 precursor sequence including a c…PromoterOsUBIAvailable SinceMarch 19, 2015AvailabilityAcademic Institutions and Nonprofits only -
EBA140-bio
Plasmid#47742PurposeExpresses enzymatically monobiotinylated full-length EBA140 ectodomain with no N-linked glycans upon cotransfection with BirA in mammalian cells. Contains a C-terminal rat Cd4 d3+4 tag.DepositorInsertCodon-optimised EBA140
UseTagsenzymatic biotinylation sequence and rat Cd4 d3+4ExpressionMammalianMutationExogenous signal peptide of mouse origin, changed…PromoterCMVAvailable SinceFeb. 4, 2014AvailabilityAcademic Institutions and Nonprofits only -
pSUC2::GNSI (NrsR)
Plasmid#121537PurposeThis plasmid contains a CYC1pr driven GNSI reporter and flanking homology to SUC2. Digestion with NotI, SacI, and EcoRV, allows integration at the SUC2 locus.DepositorInsertsCYC1 Promoter (CYC1 Budding Yeast)
Nyv1 Cytosolic Domain (aa 6-230)
Snc1 Transmembrane Domain (TMD)
SUC2 CDS
SUC2 terminator
NrsR
UseTagsmGFP5ExpressionYeastMutationM109I (Naturally occurring SNP) and The first 21 …PromoterAvailable SinceFeb. 12, 2019AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CAG-soCoChR-GFP
Plasmid#107710PurposeA somatic channelrhodopsin, which enables single cell, single millisecond resolution optogenetics. CAG promoterDepositorInsertsoCoChR-GFP
UseAAVTagsEGFP and KA2ExpressionMammalianMutationPromoterCAGAvailable SinceMay 1, 2018AvailabilityAcademic Institutions and Nonprofits only -
pGEX6P1 p37
Plasmid#169015PurposeExpresses GST-p37 (human, codon optimized for expression in bacteria)DepositorInsertp37 (UBXN2B Human)
UseTagsGSTExpressionBacterialMutationsequence was codon optimized for expression in E.…PromotertacAvailable SinceJune 24, 2021AvailabilityAcademic Institutions and Nonprofits only