We narrowed to 69,957 results for: TOR
-
Plasmid#113735PurposeGateway entry vector containing attL1 and attL2 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pMOD_A-CmYLCV-dCas9-24XGP41
Plasmid#202009PurposeMoclo level 1 - Module A, Promoter: CmYLCV, Gene: dCas9-24XGP41, Terminator: HSPDepositorInsertdCas9-24XGP41
UseSynthetic Biology; Moclo level 1 vectorTagsGS linkersPromoterCmYLCVAvailable SinceJuly 31, 2023AvailabilityAcademic Institutions and Nonprofits only -
pRK5-FLAG-RagC-D181N
Plasmid#42325DepositorAvailable SinceMarch 6, 2013AvailabilityAcademic Institutions and Nonprofits only -
pOPS0750
Plasmid#115511PurposeReporter plasmid suitable for experiments in environments where there is no antibiotic selection present. Constitutive promoter pNeo expressing gusA.DepositorInsertgusA pOGG083, T-pharma pOGG003 assembled in pOGG026
ExpressionBacterialMutationDomesticated for Golden Gate cloningPromoterConstitutive promoter pNeo pOGG001Available SinceJan. 16, 2019AvailabilityAcademic Institutions and Nonprofits only -
pAV0785
Plasmid#133507PurposeExpression of mCherry tagged PCNA to monitor DNA replicationDepositorInsertpUra4(AfeI)-p(pcn1)-mCherry-pcn1-terminator(nmt1)-natMX
ExpressionYeastAvailable SinceNov. 19, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCORE-Kp53
Plasmid#72241PurposeContains the CORE cassette with KanMX4 and human p53 gene markersDepositorAvailable SinceJan. 28, 2016AvailabilityAcademic Institutions and Nonprofits only -
pEN_TTGmiRc2
Plasmid#25753PurposeEntry vector for cloning miR30-based shRNA driven by TRE-tight promoter with GFP coexpression.DepositorTypeEmpty backboneUseEntry vectorTagsGFPAvailable SinceJuly 1, 2010AvailabilityAcademic Institutions and Nonprofits only -
pHR_PGK_SNIPR_ADAM17 site
Plasmid#188349PurposeLentiviral vector - constitutive expression of an anti-CD19 SNIPR with a ADAM17site, a Notch1-TMD, a Notch1-JMD, and a Gal4VP64 transcriptional factorDepositorInsertPGK_antiCD19_ADAM17site_Notch1-TMD_Notch1-JMD_Gal4VP64
UseLentiviralAvailable SinceMarch 9, 2023AvailabilityAcademic Institutions and Nonprofits only -
TAL-L1-1.3-VP64
Plasmid#103033PurposePlasmid for IvT reaction with T3. Encodes LINE-1 specific TALE sequence followed by VP64 activatorDepositorInsertTAL-L1-1.3-VP64
UseT3 in vitro transcription for expression in mamma…TagsHA and VP64Available SinceNov. 30, 2017AvailabilityAcademic Institutions and Nonprofits only -
pRK5-FLAG-RagB-D163N
Plasmid#42324DepositorAvailable SinceMarch 6, 2013AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pMP4518
Plasmid#107778PurposeExpression of EYFPDepositorInsertpLacZ-EYFP in pBBR1-mcs5
TagspLacZ-EYFPExpressionBacterialPromoterpLacZAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
TAL-L1-2.4-VP64
Plasmid#103039PurposePlasmid for IvT reaction with T3. Encodes LINE-1 specific TALE sequence followed by VP64 activatorDepositorInsertTAL-L1-2.4-VP64
UseT3 in vitro transcription for expression in mamma…TagsHA and VP64Available SinceNov. 30, 2017AvailabilityAcademic Institutions and Nonprofits only -
PEP112E
Plasmid#97398Purposebinary construct of mitochondria-targeted mCherry with sfGFP11 tag for plant expressionDepositorInsertmCherry-sfGFP11
TagsMitochondria targetExpressionPlantAvailable SinceSept. 25, 2017AvailabilityAcademic Institutions and Nonprofits only -
-
pENTR-PpU6P-sgRNA-L5L2
Plasmid#113738PurposeGateway entry vector containing attL5 and attL2 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pAV0782
Plasmid#133514PurposeExpression of sfGFP tagged LifeAct probe to monitor actin cytoskeletonDepositorInsertpAde6(PmeI)-p(act1)-LifeAct-sfGFP-terminator(ScADH1)-bsdMX
ExpressionYeastAvailable SinceNov. 12, 2019AvailabilityAcademic Institutions and Nonprofits only -
BcLOV-mCh-EGFR
Plasmid#208274PurposeExpresses BcLOV-EGFR for optogenetic activation of EGFR signaling. Includes an mCherry tag.DepositorInsertBcLOV-mCherry-EGFR
UseLentiviralTagsmCherryPromoterpCMVAvailable SinceJan. 25, 2024AvailabilityAcademic Institutions and Nonprofits only -
pTAJAK-71 (pESC-NatMXsyn-USER)
Plasmid#78232PurposeEmpty vector, for the insertion of gRNA expression cassettes into the vector.DepositorTypeEmpty backboneExpressionYeastAvailable SinceNov. 23, 2016AvailabilityAcademic Institutions and Nonprofits only -
pMX Vav1 uGFP
Plasmid#14557DepositorAvailable SinceApril 12, 2007AvailabilityAcademic Institutions and Nonprofits only