We narrowed to 265 results for: G1
-
Plasmid#115490PurposeCRISPR-Cas9 SunTag system to target NtDRMcd (without an NLS) to the SUPERMAN locus with two guide RNAsDepositorInsertg2_U6_g1_U6_NOS_NLS_GB1_noNLS_linker_DRMcd_linker_sfGFP_scFv_UBQ10_Insulator_UBQ10_Ω_dCas9_1xHA_3xNLS_linker_10xGCN4_OCS
UseCRISPR and Synthetic BiologyExpressionPlantAvailable SinceMarch 19, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCS2+FucciOrange
Plasmid#128427PurposeContains insert allowing in-vivo visualization of Cdk1 protein (G1)DepositorInsertFucciOrange
ExpressionMammalianPromoterCMV & SP6Available SinceJuly 13, 2020AvailabilityAcademic Institutions and Nonprofits only -
5aa SunTag VP64 AP3
Plasmid#115484PurposeCRISPR-Cas9 SunTag system to target VP64 to the AP3 locus with two guide RNAsDepositorInsertg2_U6_g1_U6_NOS_NLS_GB1_NLS_linker_VP64_linker_sfGFP_scFv_UBQ10_Insulator_UBQ10_Ω_dCas9_1xHA_2xNLS_linker_10xGCN4_OCS
UseCRISPR and Synthetic BiologyExpressionPlantAvailable SinceMarch 21, 2019AvailabilityAcademic Institutions and Nonprofits only -
G1S-HA-pCB6
Plasmid#74373PurposeMammalian expression of a G1S mutant HA from the X:31 strain of influenza virusDepositorInsertHA
ExpressionMammalianMutationG1SPromoterCMVAvailable SinceApril 13, 2016AvailabilityAcademic Institutions and Nonprofits only -
pLentiDP1.3
Plasmid#171096Purposelentiviral construct (3rd generation) for the expression of cell cycle-dependent OsTIR1 fused with mEmerald and Cdt1 (AKA ROLECCS G1) and miniAID-fused mCherry2DepositorInsertOsTIR1-mEmerald-Cdt1-P2A-miniAID-mCherry2
UseLentiviral and Synthetic BiologyTagsEmerald, cdt1, miniAID, mCherry2ExpressionMammalianPromoterCMVAvailable SinceAug. 5, 2021AvailabilityAcademic Institutions and Nonprofits only -
pAS_4xhyb PylT A41AA C55A sfGFP 150TAG
Plasmid#154772Purposeplasmid with 4xhybrid PylT cassette (Mx1201 G1 PylT hybrid mutant A41AA C55A) and amber suppression reporter sfGFP 150 TAG stop, for transient transfection or stable, piggybac-mediated, integrationDepositorInsertsfGFP
ExpressionMammalianMutation150TAG in GFP reporter, hybrid PylT with A41AA an…PromoterEF1Available SinceOct. 1, 2020AvailabilityAcademic Institutions and Nonprofits only -
pAS_4xhyb PylT sfGFP 150TAG
Plasmid#154771Purposeplasmid with 4xhybrid PylT cassette (Mx1201 G1 PylT hybrid ) and amber suppression reporter sfGFP 150 TAG stop, for transient transfection or stable, piggybac-mediated, integrationDepositorInsertsfGFP
ExpressionMammalianMutation150TAGPromoterEF1Available SinceOct. 1, 2020AvailabilityAcademic Institutions and Nonprofits only -
pSP-G1
Plasmid#64736PurposeYeast expression plasmidDepositorTypeEmpty backboneExpressionYeastAvailable SinceJune 1, 2015AvailabilityAcademic Institutions and Nonprofits only -
pCEV-G1-Ph
Plasmid#46814PurposeTEF1 and PGK1 promoter controlled expression cassettes with phleomycin resistance for yeast transformationDepositorTypeEmpty backboneTagsFLAG and c-mycExpressionYeastPromoterTEF1 and PGK1Available SinceDec. 3, 2013AvailabilityAcademic Institutions and Nonprofits only -
pMA-SpCas9-g1
Plasmid#80784PurposeBsaI-based cloning of SpCas9 gRNA guide sequence, position 1/11/21 in the arrayDepositorInsertCRISPR gRNA expression cassette (for SpCas9)
UseCRISPRTagsnaExpressionMammalianPromoterU6Available SinceSept. 13, 2016AvailabilityAcademic Institutions and Nonprofits only -
(D) crtE (E)_G1 (SBE115)
Plasmid#194994PurposeRhodotorula toruloides gene geranylgeranyl diphosphate synthase (crtE, RHTO_02504) for G1DepositorInsert(D) crtE (E)
ExpressionBacterialAvailable SinceNov. 21, 2023AvailabilityAcademic Institutions and Nonprofits only -
pAS_4xG1 PylT A41AA C55A sfGFP 150TAG
Plasmid#154770Purposeplasmid with 4xG1 PylT cassette (G1 PylT mutant A41AA C55A) and amber suppression reporter sfGFP 150 TAG stop, for transient transfection or stable, piggybac-mediated, integrationDepositorInsertsfGFP
ExpressionMammalianMutation150TAG in GFP reporter, G1 PylT with A41AA and C5…PromoterEF1Available SinceOct. 1, 2020AvailabilityAcademic Institutions and Nonprofits only -
MTK3_017
Plasmid#123732PurposeEncodes Fluorescent probe for G1/S transition as a Type 3 part to be used in the MTK systemDepositorInsertCitrine::Geminin(1-110)
ExpressionMammalianAvailable SinceDec. 13, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
ACE2 g1 + Cas9
Plasmid#153011PurposeA guide RNA targeting ACE2 in a lentiviral plasmid co-expressing Cas9 and TagBFP2DepositorAvailable SinceJune 1, 2020AvailabilityAcademic Institutions and Nonprofits only -
pET28 MBP NAAEF-AMPKa1 (13-476,529-550)-b2(76-272)-g1(24-327)
Plasmid#177850PurposeBacterial Expression of AMPKDepositorInsertAMPK (a1b2g1)
TagsMBPExpressionBacterialAvailable SinceDec. 9, 2021AvailabilityAcademic Institutions and Nonprofits only -
pX-EGFP-g1
Plasmid#107273PurposeeGFP sgRNA-1 and Cas9 expression vector (aka. pX-ps1)DepositorInsertGFP sgRNA-1
UseCRISPRExpressionMammalianPromoterU6Available SinceMarch 15, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
px458_2A_GFP_sgRNA_G3BP1_G1
Plasmid#127114DepositorInsertgRNA G3BP1 (G3BP1 Human)
UseCRISPRAvailable SinceJuly 31, 2019AvailabilityAcademic Institutions and Nonprofits only -
TMPRSS2 g1 + Cas9
Plasmid#153015PurposeA guide RNA targeting TMPRSS2 in a lentiviral plasmid co-expressing Cas9 and TagBFP2DepositorInsertCas9 + TMPRSS2 gRNA
UseCRISPR and LentiviralTagsTagBFP2Available SinceJune 1, 2020AvailabilityAcademic Institutions and Nonprofits only