We narrowed to 69,679 results for: TOR
-
Plasmid#24099DepositorAvailable SinceJuly 1, 2010AvailabilityAcademic Institutions and Nonprofits only
-
pFB-U6-control-gRNA-hSyn-mCherry-WPRE-SV40pA
Plasmid#128347PurposepAAV encoding control gRNA for CRISPR gRNAs listed aboveDepositorInsertcontrol (negative)
UseCRISPRExpressionMammalianAvailable SinceJuly 29, 2019AvailabilityAcademic Institutions and Nonprofits only -
pET41a iGluh
Plasmid#119830PurposeProduction of recombinant iGluSnFR E25A high affinity variant, a single-wavelength glutamate indicator, in E. coliDepositorInsertiGluh
TagsGSTExpressionBacterialMutationE25APromoterT7Available SinceAug. 22, 2024AvailabilityAcademic Institutions and Nonprofits only -
pFA6a-kanMX6-PGAL1-3HA
Plasmid#41608DepositorInsertGAL1 promoter (GAL1 Budding Yeast)
UseYeast genomic targetingTags3xHA, A. gossypii translation elongation factor 1…Available SinceDec. 10, 2012AvailabilityAcademic Institutions and Nonprofits only -
pSBtet-GP-α+δ
Plasmid#247177PurposeFor generating Sleeping Beauty-based stable cell line expressing human muscle acetylcholine receptor alpha1 and delta subunits. Expresses GFP; puromycin selection.DepositorInsertHuman muscle acetylcholine receptor alpha1 and delta subunits
TagsTwin strep tagExpressionMammalianAvailable SinceOct. 31, 2025AvailabilityAcademic Institutions and Nonprofits only -
pME-nls-sfGFP
Plasmid#132973Purposefull-length of nuclear localized sfGFP with stop codon in pmE Gateway vectorDepositorInsertnuclear localized super folder GFP
UseGateway vectorTags6x myc and SV40 NLSAvailable SinceDec. 4, 2019AvailabilityAcademic Institutions and Nonprofits only -
HisMBP CFlm25
Plasmid#78458PurposeInducible expression in E. coliDepositorInsertHuman Cleavage Factor lm 25 kDa subunit (NUDT21 Human)
TagsHis and MBPExpressionBacterialPromotertacAvailable SinceJuly 22, 2016AvailabilityAcademic Institutions and Nonprofits only -
pET30a-Tn5
Plasmid#127917PurposeProkaryotic expression of the unmodified Tn5 for Illumina sequencing library preperation.DepositorInsertTn5
TagsMxe intein - Chitin-binding domainExpressionBacterialMutationE54K, L372PPromoterT7Available SinceAug. 23, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pMK003
Plasmid#236570PurposeCloning vector for PaqCI Golden Gate assembly of ISDra2 guides into ISDra2 plant expression vectorDepositorTypeEmpty backboneExpressionPlantAvailable SinceMay 5, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-hSyn-JEDI-1P-Kv-WPRE
Plasmid#202612PurposeSoma and AIS-localized genetically encoded voltage indicator (GEVI) JEDI-1P in AAV production vector for neuron-specific expression using the promoter hSynDepositorInsertJEDI-1P-Kv
UseAAVExpressionMammalianPromoterhSynAvailable SinceJune 21, 2023AvailabilityAcademic Institutions and Nonprofits only -
p3xFLAG-MKL1
Plasmid#11978PurposeFor mammalian expression of human MKL1 with a 3x FLAG tagDepositorAvailable SinceAug. 10, 2007AvailabilityAcademic Institutions and Nonprofits only -
pMIG-hKLF4
Plasmid#17227DepositorAvailable SinceJan. 18, 2008AvailabilityAcademic Institutions and Nonprofits only -
pCaRNA1&2
Plasmid#86087PurposeSimultaneous expression of cDNAs of complete genomic RNA1 and RNA 2 of PNRSV (Pch12 isolate) in transfected cellsDepositorInsertRNA1, RNA2
ExpressionPlantPromoter35SAvailable SinceFeb. 7, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCaRNA3
Plasmid#86088PurposeExpression of cDNA of full-length genomic RNA3 of PNRSV (Pch12 isolate) in transfected cellsDepositorInsertRNA3
ExpressionPlantPromoter35SAvailable SinceJan. 12, 2017AvailabilityAcademic Institutions and Nonprofits only -
pDESTpK7WG2mito
Plasmid#158726PurposePlant mitoTALEN vector assembly, Destination vectorDepositorInsertmitochondrial presequence in front of attR1 in pk7WG2
ExpressionPlantAvailable SinceSept. 23, 2020AvailabilityAcademic Institutions and Nonprofits only -
pHR_PGK_SNIPR_CD8alpha variant 2
Plasmid#188362PurposeLentiviral vector - constitutive expression of an anti-CD19 SNIPR with a CD8alpha-variant2-ECD, a Notch1-TMD, a Notch1-JMD, and a Gal4VP64 transcriptional factorDepositorInsertPGK_antiCD19_CD8alpha-variant2-ECD_Notch1-TMD_Notch1-JMD_Gal4VP64
UseLentiviralAvailable SinceMarch 9, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3 ALK4 K234R
Plasmid#80881Purposemammalian expression of ALK4 K234RDepositorAvailable SinceAug. 24, 2016AvailabilityAcademic Institutions and Nonprofits only -
FHpHG_mTent5a
Plasmid#221439PurposeTransfection into the cells for the reporter or qPCR assay.DepositorAvailable SinceJune 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
PL-SIN-PGK-EiP
Plasmid#21312PurposeControl Lentiviral vector with ubiquitous PGK promoter, expresses EGFP and Puro resistanceDepositorInsertEnhanced Green Fluorescence Protein, Puromycin resistance gene
UseLentiviralExpressionMammalianPromoterPGKAvailable SinceJune 1, 2009AvailabilityAcademic Institutions and Nonprofits only