We narrowed to 25,556 results for: lars;
-
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only
-
pRK5-mFzd3-1D4
Plasmid#42265DepositorAvailable SinceMarch 28, 2013AvailabilityAcademic Institutions and Nonprofits only -
pJOG536
Plasmid#105423PurposeSynthetic biologyDepositorInsertNuclear targeting factor (RanGAP1(WPP)-GFP-BLRP)
UseSynthetic BiologyMutationBsaI/ BpiI restriction sites removedAvailable SinceAug. 1, 2018AvailabilityAcademic Institutions and Nonprofits only -
pQE30-roGFP1-iL
Plasmid#83313PurposeInducible expression of redox sensitive GFP in bacteriaDepositorInsertroGFP1-iL
Tags6xHISExpressionBacterialMutationro1(C48S/S147C/Q204C) plus X insertion, iL betwe…PromoterT5Available SinceOct. 11, 2016AvailabilityAcademic Institutions and Nonprofits only -
pTYF-sGFAP-IRES-tdTomato
Plasmid#166920PurposeEmpty plasmid backbone; includes IRES-tdTomato and sGFAP promoterDepositorTypeEmpty backboneUseLentiviralTagstdTomatoExpressionMammalianPromotersGFAPAvailable SinceApril 23, 2021AvailabilityAcademic Institutions and Nonprofits only -
pmScarlet-i_NES_C1
Plasmid#85062PurposeIn vivo visualization of the cytoplasm, but not the nucleus (can be used for colocalization studies)DepositorInsertNES
ExpressionMammalianPromoterCMVAvailable SinceDec. 6, 2016AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-L5L2
Plasmid#113738PurposeGateway entry vector containing attL5 and attL2 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pMOS009E: Entry vector for: QuasAr2-mOrange2 voltage sensor (plasma membrane)
Plasmid#163062PurposeEntry vector for: QuasAr2-mOrange2 voltage sensor (plasma membrane)DepositorInsertQuasAr2
UseGateway entry vectorTagsmOrange2Available SinceMarch 9, 2021AvailabilityAcademic Institutions and Nonprofits only -
pOGG010
Plasmid#113984PurposeVector construction module. RK2 (IncP) low-copy number origin of replication for construction of Golden Gate cloning vectorsDepositorInsertRK2 (IncP)
ExpressionBacterialMutationDomesticated for Golden Gate cloningAvailable SinceJan. 16, 2019AvailabilityAcademic Institutions and Nonprofits only -
pBFP (GB0025)
Plasmid#68193PurposeProvides the CDS of the Blue fluorescente protein as a level 0 GoldenBraid partDepositorInsertBFP coding region
UseSynthetic BiologyMutationBsaI and BsmBI sites removedAvailable SinceOct. 23, 2015AvailabilityAcademic Institutions and Nonprofits only -
pLenti-CMV-Myr-Pink Flamindo-p2a-EGFP-bPAC-CAAX
Plasmid#202719PurposeMammalian co-expression of membrane-bound Pink Flamindo and membrane-bound bPAC for cAMP perturbation and imagingDepositorArticleInsertsMyr-Pink Flamindo
EGFP-bPAC-CAAX
UseLentiviralExpressionMammalianPromoterCMVAvailable SinceAug. 3, 2023AvailabilityAcademic Institutions and Nonprofits only -
pGFP FAT
Plasmid#50517PurposeThis plasmid contains GFP21, which has a sequence similar to YFP, but emission/excitation similar to GFP.DepositorInsertprotein tyrosine kinase, domain
TagsGFPExpressionMammalianMutationtruncated (NT2630-3268)PromoterCMVAvailable SinceJan. 7, 2014AvailabilityAcademic Institutions and Nonprofits only -
Rix-PGK-Tom-W
Plasmid#25813DepositorInsertRix-PGK-Tom-W
UseLentiviralMutationtdTomato from Tsien labAvailable SinceJune 9, 2011AvailabilityAcademic Institutions and Nonprofits only -
FLAG-mTIP49a
Plasmid#15357DepositorInsertTATA binding protein interacting protein 49 kDa (Ruvbl1 Mouse)
TagsFLAGExpressionMammalianAvailable SinceAug. 17, 2007AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-C1 beta-catenin Y654E
Plasmid#16073DepositorAvailable SinceNov. 2, 2007AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1_Tiam1-pMagFast2(3x)-iRFP
Plasmid#67299PurposeBlue light dependent photoswitching systemDepositorAvailable SinceJuly 9, 2015AvailabilityAcademic Institutions and Nonprofits only -
pSicoR human DGCR8-2
Plasmid#14770DepositorAvailable SinceApril 5, 2007AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-R4R3
Plasmid#113739PurposeGateway entry vector containing attR4 and attR3 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-L5L4
Plasmid#113741PurposeGateway entry vector containing attL5 and attL4 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pENTR-PpU6P-sgRNA-L1R5
Plasmid#113737PurposeGateway entry vector containing attL1 and attR5 sites, U6 promoter, BsaI sites for protospacer ligation, and sgRNA.DepositorInsertPpU6P::sgRNA
UseCRISPR; Gateway entry vectorPromoterP. patens U6 promoterAvailable SinceSept. 24, 2018AvailabilityAcademic Institutions and Nonprofits only