We narrowed to 60,551 results for: Gene
-
Plasmid#110560PurposeminiTn7 delivery plasmid with rhaSR-PrhaBAD inducible promoter and StRBS-lacZ insertDepositorInsertstRBS-lacZ
ExpressionBacterialPromoterrhaSR-PrhaBADAvailable SinceMay 23, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVNā¦ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pExodus
Plasmid#39991DepositorTypeEmpty backboneExpressionBacterial and MammalianPromoterCMV, T7Available SinceSept. 27, 2012AvailabilityAcademic Institutions and Nonprofits only -
Lenti-sgCrebbp#2/Cre
Plasmid#193210PurposeLentiviral vector expressing Cre recombinase (driven by mPGK promoter) and an sgRNA against the mouse Crebbp geneDepositorAvailable SinceDec. 12, 2022AvailabilityAcademic Institutions and Nonprofits only -
p426_Cas9_gRNA-HIS3b
Plasmid#87402PurposeAll-in-one CRISPR plasmid for integrating, deleting, or replacing a gene in S. cerevisiae. High-copy, URA3 plasmid contains human codon-optimized Cas9 and a guide RNA targeting HIS3b sequence AATATAGAGTGTACTAGAGG in yeast chromosome 15.DepositorInsertHuman Optimized S. pyogenes Cas9 and guide RNA targeting HIS3b
UseCRISPRPromoterADH1, pTyrosineAvailable SinceApril 5, 2017AvailabilityAcademic Institutions and Nonprofits only -
p426_Cas9_gRNA-ARS208a
Plasmid#87383PurposeAll-in-one CRISPR plasmid for integrating, deleting, or replacing a gene in S. cerevisiae. High-copy, URA3 plasmid contains human codon-optimized Cas9 and a guide RNA targeting ARS208a sequence GTCCGCTAAACAAAAGATCT in yeast chromosome 2.DepositorInsertHuman Optimized S. pyogenes Cas9 and guide RNA targeting ARS208a
UseCRISPRPromoterADH1, pTyrosineAvailable SinceApril 5, 2017AvailabilityAcademic Institutions and Nonprofits only -
p426_Cas9_gRNA-ARS416d
Plasmid#87386PurposeAll-in-one CRISPR plasmid for integrating, deleting, or replacing a gene in S. cerevisiae. High-copy, URA3 plasmid contains human codon-optimized Cas9 and a guide RNA targeting ARS416d sequence TAGTGCACTTACCCCACGTT in yeast chromosome 4.DepositorInsertHuman Optimized S. pyogenes Cas9 and guide RNA targeting ARS416d
UseCRISPRPromoterADH1, pTyrosineAvailable SinceApril 5, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCfB2903(XI-2 MarkerFree)
Plasmid#73275PurposeEasyClone-MarkerFree backbone vector for the addition of 1 or 2 genes and promoters for integration into site XI-2 (Chr XI: 91575..92913)DepositorTypeEmpty backboneUseCRISPR and Synthetic BiologyExpressionYeastAvailable SinceNov. 23, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCfB2899(X-2 MarkerFree)
Plasmid#73271PurposeEasyClone-MarkerFree backbone vector for the addition of 1 or 2 genes and promoters for integration into site X-2 (Chr X: 194944..195980)DepositorTypeEmpty backboneUseCRISPR and Synthetic BiologyExpressionYeastAvailable SinceNov. 23, 2016AvailabilityAcademic Institutions and Nonprofits only -
pEMS1985
Plasmid#49116PurposeThe plasmid contains the Pleaides (Ple) MiniPromoter Ple155 derived from the human PCP2 gene and designed for expression in ON Bipolar cells of the retina.DepositorInsertssAAV-Ple155-iCre
UseAAVExpressionMammalianPromoterMiniPromoter Ple155 from the human PCP2 geneAvailable SinceMay 10, 2016AvailabilityIndustry, Academic Institutions, and Nonprofits -
pcDNA-dCas9-p300 Core (H1415A/E1423A/Y1424A/L1428S/Y1430A/H1434A)
Plasmid#61364Purposeencodes S. pyogenes dCas9 with c-terminal fusion of human p300 HAT core (aa 1048-1664; inactivating mutations H1415A/E1423A/Y1424A/L1428S/Y1430A/H1434A) driven by CMV promoterDepositorInsertS.pyogenes dCas9 with c-terminal human p300 Core effector fusion (aa 1048-1664 of human p300) (EP300 S. pyogenes, Synthetic, Human)
UseCRISPR and Synthetic BiologyTagsFlag, HA, and SV40 NLSExpressionMammalianMutationD10A; H840A in S.pyogenes Cas9; H1415A/E1423A/Y14ā¦PromoterCMVAvailable SinceApril 10, 2015AvailabilityAcademic Institutions and Nonprofits only -
pHK316
Plasmid#235474PurposeInducible gene VIII by Ptet promoterDepositorInsertphage M13 geneVIII
ExpressionBacterialAvailable SinceMay 9, 2025AvailabilityAcademic Institutions and Nonprofits only -
pC016-gPsp-EGFP_start_codon
Plasmid#233613PurposeExpression of guide RNA targeting the start codon of the EGFP gene for PspCas13bDepositorInsertgRNA targeting EGFP
UseCRISPRAvailable SinceMarch 11, 2025AvailabilityAcademic Institutions and Nonprofits only -
pGP-Tn7-PcL
Plasmid#225281PurposeMini-Tn7 pGP-Tn7-Cm vector with constitutive PcL promoter for the constitutive expression of target genes inserted into the attTn7 chromosomal site.DepositorTypeEmpty backboneExpressionBacterialPromoterConstitutive PcL promoterAvailable SinceJan. 9, 2025AvailabilityAcademic Institutions and Nonprofits only -
pMTG8-Amp-FRT
Plasmid#128277PurposeTIP-LITer2.0-KRAS(G12V) gene circuit with the following architecture: CMV-TetOx2-TetR-LOV-TIP-P2A-KRAS(G12V)-P2AGFPDepositorInsertsTetR-LOV-TIP
EGFP
KRAS(G12V)
UseSynthetic BiologyExpressionMammalianPromoterCMVAvailable SinceJuly 30, 2019AvailabilityAcademic Institutions and Nonprofits only -
BB1_P_12_asn_mbfA
Plasmid#90289PurposeBB1 promoter mbfA gene of Aspergillus niger between FS1 and FS2DepositorInsertmbfA
ExpressionBacterialAvailable SinceJuly 5, 2017AvailabilityAcademic Institutions and Nonprofits only -
pmCherry.LIC.HXGPRT
Plasmid#83364PurposePlasmid contains LIC cassette upstream of an in-frame copy of mCherry and HXGPRT selectable marker cassette for endogenous tagging on the gene locusDepositorInsertmCherry
UseToxoplasma gondiiTagsmCherryAvailable SinceNov. 11, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCFP.HXGPRT
Plasmid#83366PurposePlasmid contains LIC cassette upstream of an in-frame copy of CFP and HXGPRT selectable marker cassette for endogenous tagging on the gene locusDepositorInsertCFP
UseToxoplasma gondiiTagsCFPAvailable SinceNov. 11, 2016AvailabilityAcademic Institutions and Nonprofits only -
pT7TS-rich
Plasmid#99050PurposeThis plasmid is useful for in vitro transcription of genes using T7 promoter. Can be used for Xenopus oocyte assay. It is derived from pT7TS. More sites for cloning are incorporated.DepositorTypeEmpty backboneUseUnspecified; Xenopus oocyte systemPromoterpT7Available SinceAug. 22, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCW-tTRE-scFv-SunTag
Plasmid#193138PurposeExpresses scFv intracellular antibody component of the SunTag system under Dox regulationDepositorInsertscFv-SunTag
UseLentiviralExpressionMammalianPromotertight TRE promoterAvailable SinceNov. 10, 2022AvailabilityAcademic Institutions and Nonprofits only -
pTarget TMEM97-P2A-mCardinal
Plasmid#157747PurposeExpress in mammalian cells TMEM97 and mCardianl to follow transfection efficiency using flow cytometry. mCardinal is expressed following a P2A skip peptide so it is not connected to TMEM97.DepositorInsertTMEM97 (TMEM97 Human)
ExpressionMammalianAvailable SinceAug. 10, 2020AvailabilityIndustry, Academic Institutions, and Nonprofits -
CMV-Tagger
Plasmid#129396PurposeExpresses 2A-separated rpl22, UPRT, mKate2 and Ago2 driven by CMV promoterDepositorInsertrpl22-HA-2A-UPRT-mKate2-FLAG-V5-Ago2
TagsFLAG, HA, and V5ExpressionMammalianPromoterCMVAvailable SinceMarch 18, 2020AvailabilityAcademic Institutions and Nonprofits only -
pX330-COSMC-KO
Plasmid#80008PurposegRNA to knock out expression of COSMC (C1GalT1C1) gene. The product of this gene is a chaperone aiding in synthesis of Core1 structures on O-linked glycans.DepositorInsertCOSMC (C1GALT1C1 Human)
UseCRISPRAvailable SinceJuly 25, 2016AvailabilityAcademic Institutions and Nonprofits only -
pWH1266-Apra-sgRNA
Plasmid#218372PurposesgRNA expression plasmid for CRISPR-intereferenceDepositorInsertsgRNA expression cassette
UseCRISPRExpressionBacterialPromoterJ23119Available SinceMay 2, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA-tdMCP-msfGFP(V206K)-GBI
Plasmid#205163Purposeexpress tdMCP-msfGFP(V206K)-GBIDepositorInserttdMCP-msfGFP(V206K)-GBI
ExpressionBacterial and MammalianPromoterCMVAvailable SinceOct. 18, 2023AvailabilityAcademic Institutions and Nonprofits only -
pAct-dCBEevoCDA1
Plasmid#195515PurposeUbiquitous expression of dCBEevoCDA1 in DrosophilaDepositorInsertdCBE-evoCDA1
UseCRISPRExpressionInsectPromoteract5CAvailable SinceSept. 12, 2023AvailabilityAcademic Institutions and Nonprofits only -
pEXP5-NT/pT7 LuxI
Plasmid#193626PurposeConstitutive T7 RNAP-mediated expression of LuxI 3OC6-HSL synthase for Lux quorum sensing system. LuxI sequence is codon optimized for E. coli.DepositorInsertLuxI
Tags6xHisExpressionBacterialPromoterT7 RNAP promoterAvailable SinceJuly 18, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-MS2-HA-HsSmg5_T
Plasmid#147552PurposeMammalian Expression of HsSmg5DepositorInsertHsSmg5 (SMG5 Human)
ExpressionMammalianMutationone silent mutation compared to the sequence giveā¦Available SinceMarch 16, 2023AvailabilityAcademic Institutions and Nonprofits only -
-
pXWS40tetO
Plasmid#160827Purpose40 repeats of tetO spongeDepositorInsert(40 X tetO)-t
UseSynthetic BiologyAvailable SinceNov. 19, 2020AvailabilityAcademic Institutions and Nonprofits only