We narrowed to 31,460 results for: REP
-
Plasmid#159130Purposeexpresses BACH1 in mammalian cellsDepositorAvailable SinceSept. 21, 2020AvailabilityAcademic Institutions and Nonprofits only
-
pCDNA4.TO-ORF64-2xNSTREP
Plasmid#136224PurposeExpresses N-terminally strep tagged Kaposi's Sarcoma Associated Herpesvirus (KSHV) ORF64DepositorInsertORF64
ExpressionMammalianPromoterCMVAvailable SinceJan. 9, 2020AvailabilityAcademic Institutions and Nonprofits only -
TRE reporter backbone
Plasmid#158678PurposeThis plasmid serves as the backbone for the TRE reporters described in our paper. It's a promoterless-mStrawberry-pGK-BSD backbone to which we insert a pathway specific promoter before the mStrawberryDepositorTypeEmpty backboneUseLentiviralTagsmStrawberryExpressionMammalianAvailable SinceMay 18, 2022AvailabilityAcademic Institutions and Nonprofits only -
CRISPR-SP-Cas9 reporter
Plasmid#62733PurposeMammalian CRISPR-SP-Cas9 reporterDepositorInsertCRISPR-SP-Cas9 target seq + tdTomato (out of frame)
UseCRISPR and LentiviralTagsCRISPR-SP-Cas9 target seq (hAAVS1 locus) and HA t…ExpressionMammalianPromoterEF1-AlphaAvailable SinceApril 24, 2015AvailabilityAcademic Institutions and Nonprofits only -
FL MALT1 WT in pET29b-Strep
Plasmid#48968PurposeExpresses Full length wild type MALT1 in e.coliDepositorAvailable SinceNov. 6, 2013AvailabilityAcademic Institutions and Nonprofits only -
pLV-REPORT(PGK)
Plasmid#172328PurposeLV REPORT containing minimal promoter driving monomeric nuclear Tomato 2a HSVtk 2a Neo followed by an PGK promoter driving nuclear d2eGFP E2A HygromycinDepositorInsertsmonomeric nuclear Tomato
d2eGFP
HygR
UseLentiviral and Synthetic BiologyTags3x SV40 NLSExpressionMammalianPromoterPGKAvailable SinceJune 26, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5FRT/TO-SVIP-Strep-HA
Plasmid#113491PurposeExpression of human SVIP with C-terminal strep-HA tagDepositorInsertSVIP (SVIP Human)
Tags2xstrep-HAExpressionMammalianMutationwildtype without stop codonPromoterCMVAvailable SinceAug. 15, 2018AvailabilityAcademic Institutions and Nonprofits only -
pTwist-CMV-HDGFL2_Cryptic_TwinstrepTEV_6xHis
Plasmid#232344PurposeExpresses human HDGFL2 protein with TDP-43 regulated cryptic exon, along with an N-terminal twinstrep tag + TEV protease site and C-terminal His-tagDepositorInsertHDGF Like 2 (HDGFL2 Human)
TagsGGGS linker, 6xHis and Twin-strep, TEV protease s…ExpressionMammalianMutationTDP-43 regulated cryptic exonAvailable SinceFeb. 21, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1_ 2xFLAG-2xSTREP_KEAP1
Plasmid#159128Purposeexpresses KEAP1 in mammalian cellsDepositorAvailable SinceSept. 17, 2020AvailabilityAcademic Institutions and Nonprofits only -
7TFP CDH1 reporter
Plasmid#91704Purposelentiviral luciferase reporter containing CDH1 promoterDepositorInsertCDH1 promoter (CDH1 Human)
UseLentiviral and LuciferaseTagsluciferaseExpressionMammalianPromoterCDH1Available SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pSHDY*in_PpetE:BCD2:MrBBS:Strep
Plasmid#133973PurposeHeterologous, copper-inducible expression of (-)-α- bisabolol synthase from Matricaria recutita (MrBBS) in Synechocystis sp. PCC 6803. The MrBBS CDS is fused to a C-termial StrepII-tag.DepositorInsertMrBBS:StrepII
UseSynthetic BiologyTagsStrepIIExpressionBacterialMutationinserted gene is codon optimized for Synechocyst…PromoterPpetE:BCD2Available SinceApril 6, 2020AvailabilityAcademic Institutions and Nonprofits only -
pmiR-report-MYB-WT
Plasmid#141114PurposeReporter plasmid of WT MYB in mammalian cells.DepositorAvailable SinceOct. 13, 2020AvailabilityAcademic Institutions and Nonprofits only -
Dead Streptavidin-SpyTag
Plasmid#59548PurposepET21-DTag encodes Dead streptavidin (negligible biotin binding) bearing a C-terminal SpyTag, for generation of chimeric SpyAvidin tetramersDepositorInsertDead Streptavidin-SpyTag
TagsSpyTagExpressionBacterialMutationThe construct lacks final K of SpyTagPromoterT7Available SinceOct. 3, 2014AvailabilityAcademic Institutions and Nonprofits only -
pBM-strep-UCP1
Plasmid#216207Purposefor expression of human strep-tagged UCP1 protein in BacMam systemDepositorAvailable SinceApril 22, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA4/TO/Strep-HA-ZAKalpha_deltaCTD
Plasmid#141196PurposeExpresses Strep-HA-ZAKalpha_deltaCTD in mammalian cells, can be used to make inducible cell linesDepositorInsertMAP3K20 (MAP3K20 Human)
TagsStrep, HAExpressionMammalianMutationdeletion of last 27 amino acidsPromoterCMVAvailable SinceJune 5, 2020AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5FRT/TO-UBXD7-Strep-HA
Plasmid#113479PurposeExpression of human UBXD7 with C-terminal strep-HA tagDepositorInsertUBXD7 (UBXN7 Human)
Tags2xstrep-HAExpressionMammalianMutationA834C silent mutation, wildtype without stop codonPromoterCMVAvailable SinceAug. 15, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1_ 2xFLAG-2xSTREP_FBXO22
Plasmid#159127Purposeexpresses FBXO22 in mammalian cellsDepositorAvailable SinceSept. 18, 2020AvailabilityAcademic Institutions and Nonprofits only -
IQ-compete reporter (integrating)
Plasmid#247176PurposePlasmid for genomic integration of the IQ-compete reporter (GFP-TCS-Quencher-CL1) into the YPRCΔ15 locus of yeast cells.DepositorInsertGFP-TCS-Quencher-CL1
ExpressionYeastPromoterTEF1Available SinceNov. 5, 2025AvailabilityAcademic Institutions and Nonprofits only -
pLIB-Strep(II)(C)-CTR9
Plasmid#231725PurposeProtein expression in insect cellsDepositorAvailable SinceMay 2, 2025AvailabilityAcademic Institutions and Nonprofits only