We narrowed to 22,874 results for: REP
-
Plasmid#211911PurposeReplicative vector for protein expression in Bacteroidales with an aTc inducible promoter, terminator, and a barcoding site.DepositorTypeEmpty backboneExpressionBacterialAvailable SinceFeb. 2, 2024AvailabilityAcademic Institutions and Nonprofits only
-
pReporter_7
Plasmid#60567PurposeA reporter plasmid containing the attB and attP sites flanking a green fluorescent protein reporter gene (gfp).DepositorInsertReporter_7
ExpressionBacterialPromoterBBa_J23119Available SinceMarch 16, 2015AvailabilityAcademic Institutions and Nonprofits only -
pSG4K5
Plasmid#74492PurposeFor cloning and constitutive expression of sgRNAs in E.coli. New sgRNAs are cloned into SapI sites and multiplex sgRNAs are cloned into BsaI sites. Kanamycin resistant with pSC101 origin of rep.DepositorInsertsgRNA
UseCRISPR and Synthetic BiologyExpressionBacterialPromoterJ23119Available SinceMay 16, 2016AvailabilityAcademic Institutions and Nonprofits only -
7i sgRNA for 4-μHOM reporter
Plasmid#113626PurposesgRNA/CAS9 expression plasmid to induce a 3’ double-strand break in the 4-μHOM reporter 8 nts. upstream from the microhomologyDepositorInsert7i sgRNA
UseCRISPRExpressionMammalianAvailable SinceAug. 13, 2018AvailabilityAcademic Institutions and Nonprofits only -
pNL-EGFP/TREPittdU3
Plasmid#18659DepositorInsertEGFP
UseLentiviralAvailable SinceJuly 8, 2008AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5FRT/TO-Ufd1-Strep-HA
Plasmid#113474PurposeExpression of human Ufd1 with C-terminal strep-HA tagDepositorInsertUfd1 (UFD1 Human)
Tags2xstrep-HAExpressionMammalianMutationwildtype without stop codonPromoterCMVAvailable SinceAug. 14, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAB1923 REPAIR.t1-S
Plasmid#176321PurposeCMV-HIVNES-GS-dCas13bt1- (GGS)2- huADAR2dd(E488Q/E620G/Q696L) (REPAIR.t1-S expression, specificity enhancing mutations)DepositorInsertsUseCRISPRTagsHIV NESExpressionMammalianMutationE488Q/E620G/Q696L, only the deaminase domain (aa …PromoterCMVAvailable SinceOct. 14, 2021AvailabilityAcademic Institutions and Nonprofits only -
Strep-KIFC1*-HA
Plasmid#120171PurposeExpresses a chimera of streptavidin, a KIFC1-based retrograde motor and HA tagDepositorInsertkinesin family member C1 (KIFC1 Human)
TagsHA and StreptavidinExpressionMammalianMutationTruncated KIFC1: 125-673 aaPromoterCMVAvailable SinceJuly 30, 2019AvailabilityAcademic Institutions and Nonprofits only -
strep-IRF8
Plasmid#102872PurposeExpress strep-tagged mouse IRF8 protein in E. coliDepositorAvailable SinceApril 5, 2019AvailabilityAcademic Institutions and Nonprofits only -
Tol2_ISCro4_Inversion_Reporter
Plasmid#251499PurposeReporter plasmid for monitoring inversion activity of ISCro4 bridge recombinase in the presence of native bridge RNA or native TBL and DBL componentsDepositorInsertISCro4 inversion reporter
ExpressionMammalianMutationNAAvailable SinceFeb. 5, 2026AvailabilityAcademic Institutions and Nonprofits only -
gRNA_tdtomato_reporter_1_SA-2x
Plasmid#79369PurposeAssays activity of transcriptional activators fused to SA Cas9DepositorInserttdtomato
UseCRISPRExpressionMammalianAvailable SinceAug. 3, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCRISPReporter
Plasmid#65007PurposeE. coli reporter vector with MCS for inserting bacterial promoter region through 5' end of gene of interest, upstream and in-frame with reporter cloning siteDepositorTypeEmpty backboneUseCRISPR and Synthetic BiologyExpressionBacterialPromoternoneAvailable SinceMay 27, 2015AvailabilityAcademic Institutions and Nonprofits only -
pReporter_3
Plasmid#60564PurposeA reporter plasmid containing the attB and attP sites flanking a green fluorescent protein reporter gene (gfp).DepositorInsertReporter_3
ExpressionBacterialPromoterBBa_J23119Available SinceMarch 16, 2015AvailabilityAcademic Institutions and Nonprofits only -
pReporter_2
Plasmid#60563PurposeA reporter plasmid containing the attB and attP sites flanking a green fluorescent protein reporter gene (gfp).DepositorInsertReporter_2
ExpressionBacterialPromoterBBa_J23119Available SinceMarch 16, 2015AvailabilityAcademic Institutions and Nonprofits only -
7h sgRNA for 4-μHOM reporter
Plasmid#113625PurposesgRNA/CAS9 expression plasmid to induce a 3’ double-strand break in the 4-μHOM reporter at the edge of the microhomology.DepositorInsert7h sgRNA
UseCRISPRExpressionMammalianAvailable SinceAug. 13, 2018AvailabilityAcademic Institutions and Nonprofits only -
SeeSaw Reporter (SSR1.0)
Plasmid#50392PurposeSSR1.0 has a one I-SceI target site for generate specific double strand break after I-SceI endonuclease expression.DepositorInsertSSR1.0
ExpressionMammalianPromoterCMVAvailable SinceFeb. 14, 2014AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5FRT/TO-UBXD8-Strep-HA
Plasmid#113477PurposeExpression of human UBXD8 with C-terminal strep-HA tagDepositorInsertUBXD8 (FAF2 Human)
Tags2xstrep-HAExpressionMammalianMutationwildtype without stop codonPromoterCMVAvailable SinceAug. 14, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1(-)-HA-SrtAstrep (pKS77)
Plasmid#50030PurposeExpression of cytosolic S. pyogenes SrtA in mammalian cellsDepositorInsertSrtA(strep)
TagsHAExpressionMammalianPromoterpCMVAvailable SinceDec. 13, 2013AvailabilityAcademic Institutions and Nonprofits only -
FL MALT1 WT in pET29b-Strep
Plasmid#48968PurposeExpresses Full length wild type MALT1 in e.coliDepositorAvailable SinceNov. 6, 2013AvailabilityAcademic Institutions and Nonprofits only