We narrowed to 6,226 results for: ARL
-
Plasmid#90383PurposeEGR1 - Early growth response factor gene reporterDepositorInsertFirefly luciferase
UseLentiviralPromoterEGR1Available SinceNov. 11, 2022AvailabilityAcademic Institutions and Nonprofits only -
pGY037 BSMV-gamma-AmCyan
Plasmid#234818PurposeTo express flourescent protein AmCyan from the gamma genome of Barley Stripe Mosaic Virus Vector (T-DNA)DepositorInsertAmCyan
ExpressionPlantAvailable SinceMay 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pME-nlsGFP-P2A
Plasmid#80808Purposenuclear localization signal fused to N-terminus of GFP (nlsGFP) without stop codon, followed by P2ADepositorInsertminimal cytomegalovirus immediate early enhancer/promoter
Available SinceNov. 1, 2016AvailabilityAcademic Institutions and Nonprofits only -
LV-TRE-WT human MyoD-T2A-dsRedExpress2
Plasmid#60628PurposeExpresses WT human MyoD and dsRedExpress2 in response to doxycyclineDepositorAvailable SinceDec. 11, 2014AvailabilityAcademic Institutions and Nonprofits only -
MCP/PCP red RNA Lantern
Plasmid#226097PurposeRNA trackingDepositorInsertNLS-HA-MS2-SmBiT-IRES-PP7-mScarlet-I-LgBiT-FLAG
ExpressionMammalianPromoterCMVAvailable SinceJan. 8, 2025AvailabilityAcademic Institutions and Nonprofits only -
pOD_009
Plasmid#159520PurposeRifampicin version of the scarless genome engineering pDEL plasmid (Tikh et al. 2016) compatible with SalmonellaDepositorTypeEmpty backboneUseSynthetic BiologyAvailable SinceSept. 30, 2022AvailabilityIndustry, Academic Institutions, and Nonprofits -
pLVX-EF1a-EGFP-RAB5A-IRES-Puromycin
Plasmid#134858PurposeExpresses EGFP-tagged early endosome markerDepositorInsertRas-related protein 5A
UseLentiviralTagsEGFPExpressionMammalianPromoterEF1aAvailable SinceMarch 2, 2020AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1/hChR2(H134R)-mCherry
Plasmid#20938PurposeMammalian expression of humanized ChR2 with H134R mutation fused to mCherry for optogenetic activationDepositorInsertchannelrhodopsin-2
ExpressionMammalianMutationH134R mutation in ChR2PromoterCMVAvailable SinceJune 1, 2009AvailabilityAcademic Institutions and Nonprofits only -
pLenti-mCherry-CAAX
Plasmid#129285PurposeLentiviral plasmid for expression of fluorescent reporter mCherry targeted to the plasma membrane via CAAX polybasic sequenceDepositorInsertFluorescent reporter mCherry fused to CAAX polybasic sequence
UseLentiviralTagsCAAXExpressionMammalianPromoterCMV promoterAvailable SinceJune 22, 2022AvailabilityAcademic Institutions and Nonprofits only -
pLV hUbC-dCas9 VP64-T2A-GFP
Plasmid#53192PurposeCo-expresses human optimized S. pyogenes dCas9-VP64 and GFPDepositorInserthumanized dead Cas9 VP64 T2A GFP
UseCRISPR and LentiviralTagsFlagExpressionMammalianMutationD10A and H840APromoterhUbCAvailable SinceJune 25, 2014AvailabilityAcademic Institutions and Nonprofits only -
pY2
Plasmid#218115PurposeActivity reporter backbone with an empty protease cassette (BsaI) under (lexA-box)3PminCYC1 promoter and an empty substrate cassette (BsmBI) under pGAL1 promoter.DepositorTypeEmpty backboneExpressionBacterial and YeastAvailable SinceApril 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
Lenti-PEAR-mCherry
Plasmid#228892PurposeAll-in-one lentiviral version of the PEAR reporter. Constitutive RFP expression with GFP turned on in event of prime editing.DepositorInsertEGFP-IRES-mScarlet
UseCRISPR and LentiviralExpressionMammalianAvailable SinceDec. 6, 2024AvailabilityAcademic Institutions and Nonprofits only -
pDEST-EGFP-TARG1
Plasmid#172586PurposeFor transient expression of N-terminal GFP-tagged TARG1DepositorAvailable SinceApril 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-mNox4
Plasmid#69353Purposeexpresses mouse Nox4 in mammalian cellsDepositorAvailable SinceMarch 15, 2016AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1/hChR2(H134R)-EYFP
Plasmid#20940PurposeMammalian expression of humanized ChR2 with H134R mutation fused to EYFP for optogenetic activationDepositorInsertchannelrhodopsin-2
ExpressionMammalianMutationH134R mutation in ChR2PromoterCMVAvailable SinceMay 13, 2009AvailabilityAcademic Institutions and Nonprofits only -
pAAV-Ef1a-DIO ChETA-EYFP
Plasmid#26968PurposeAAV expression of humanized ChR2 with E123T/H134R mutations fused to EYFP driven by EF1a promoter for optogenetic activationDepositorHas ServiceAAV1, AAV5, and AAV9InserthChR2(E123T/H134R)-EYFP
UseAAVTagsEYFPExpressionMammalianMutationE123T, H134RPromoterEF1alphaAvailable SinceJan. 28, 2011AvailabilityAcademic Institutions and Nonprofits only -
pLenti-hSyn-eNpHR 3.0-EYFP
Plasmid#26775Purpose3rd gen lentiviral expression of eNpHR 3.0 fused to EYFP driven by human Synapsin I promoter for optogenetic inhibitionDepositorInserteNpHR 3.0
UseLentiviralTagsEYFPExpressionMammalianMutationTrafficking Signal (TS) ER Export SignalPromoterhSynAvailable SinceJan. 27, 2011AvailabilityAcademic Institutions and Nonprofits only -
pRGEB32-BAR
Plasmid#126072PurposeFor CRISPR/Cas9 delivery in maize. Expresses Cas9 with rice ubiquitin promoter, BAR with 35S promoter, and sgRNA/PTG with rice snoRNA U3 promoter (pol III). Can produce 1 or more gRNAs.DepositorTypeEmpty backboneUseCRISPRExpressionPlantPromoter35S for BAR; Rice UBI for Cas9; Rice snoRNA U3 fo…Available SinceJune 24, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pLenti-mCherry-CAAX
Plasmid#166229PurposeLentiviral plasmid for expression of mCherry with a C-terminal CAAX polybasic sequence from KRras targeting mCherry to the plasma membrane.DepositorInsertmCherry-CAAX
UseLentiviralTagsCAAXExpressionMammalianPromoterCMVAvailable SinceJan. 30, 2024AvailabilityAcademic Institutions and Nonprofits only