We narrowed to 8,397 results for: gal
-
Plasmid#69881Purposea dCirl transcriptional reporter allele that contains an optimized gal4.2::p65 cassette at the start codon of the genomic dCirl ORFDepositorInsertCIRL (Cirl Fly)
UsePhic31-integration vectorAvailable SinceJune 24, 2022AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0869
Plasmid#177086PurposeMoClo Level 1, position 5, transcriptional unit for transient expression of 7-deoxyloganic acid hydroxylase (Cr7-DLH) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert7-deoxyloganic acid hydroxylase (Cr7-DLH) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0867
Plasmid#177085PurposeMoClo Level 1, position 3, transcriptional unit for transient expression of 7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0806
Plasmid#177080PurposeMoClo Level 1, position 3, transcriptional unit for transient expression of loganic acid O-methyltransferase (CrLAMT) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsertloganic acid O-methyltransferase (CrLAMT) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0804
Plasmid#177079PurposeMoClo Level 1, position 2, transcriptional unit for transient expression of 7-deoxyloganic acid hydroxylase (Cr7-DLH) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert7-deoxyloganic acid hydroxylase (Cr7-DLH) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0798
Plasmid#177077PurposeMoClo Level 1, position 5, transcriptional unit for transient expression of iridoid oxidase; CYP76A26 (CrIO) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsertiridoid oxidase; CYP76A26 (CrIO) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0792
Plasmid#177076PurposeMoClo Level 1, position 2, transcriptional unit for transient expression of major latex protein-like (NmMLPL) from Nepeta mussinii promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsertmajor latex protein-like (NmMLPL) from Nepeta mussinii
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0786
Plasmid#177071PurposeMoClo Level 1, position 3, transcriptional unit for transient expression of geranyl pyrophosphate synthase (PaGPPS1) from Picea abies promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsertgeranyl pyrophosphate synthase (PaGPPS1) from Picea abies
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0785
Plasmid#177070PurposeMoClo Level 1, position 2, transcriptional unit for transient expression of 1-deoxy-D-xylulose 5-phosphate synthase (CrDXS2) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert1-deoxy-D-xylulose 5-phosphate synthase (CrDXS2) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0861
Plasmid#177078PurposeMoClo Level 1, position 6, transcriptional unit for transient expression of 7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 3, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0796
Plasmid#177074PurposeMoClo Level 1, position 4, transcriptional unit for transient expression of 8-hydroxygeraniol oxidoreductase (CrGOR) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert8-hydroxygeraniol oxidoreductase (CrGOR) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 3, 2021AvailabilityAcademic Institutions and Nonprofits only -
-
CMYA5T/pACT2
Plasmid#97209PurposeCMYA5 (aa 4039 – 4069) Leu allele (4063) in a GAL4 AD vector, used for yeast-two hybridDepositorAvailable SinceAug. 21, 2017AvailabilityIndustry, Academic Institutions, and Nonprofits -
pcDNA5 FRT TO myc Separase delta 55
Plasmid#59824PurposeAllows the integration of myc Separase delta 55 in the genome and Tet-inducible expression.DepositorInsertSeparase (ESPL1 Human)
TagsMycExpressionMammalianMutationdelta 55Promoterhybrid human cytomegalovirus (CMV)/TetO2 promoterAvailable SinceFeb. 18, 2015AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-GFP(LaG17) PAGER(TF)
Plasmid#229997PurposeExpresses anti-GFP PAGER(TF) (high reversibility) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-LaG17-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pGMβ1
Plasmid#216202PurposeChromosomal gene manipulation (gene insertion, conversion, deletion) of dairy used Lactobacillus bulgaricus, a difficult gene to manipulate, is now possible by conjugation using this pGMB1 plasmid.DepositorTypeEmpty backboneUseShuttle vector, conjugal plasmid, theta type rep…ExpressionBacterialPromoterlac promoter in pGEM-Teasy, Promoters in pAMbeta1…Available SinceJan. 21, 2025AvailabilityIndustry, Academic Institutions, and Nonprofits -
pBD-PYR1_star-MANDI
Plasmid#241280PurposeYeast two hybrid vector expressing BD-PYR1_star-MANDIDepositorAvailable SinceSept. 8, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-PDL1(KN035) PAGER(TF)
Plasmid#230003PurposeExpresses anti-PDL1 PAGER(TF) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-KN035-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.4 human alpha5 full
Plasmid#221396PurposeMammalian expression of human integrin alpha5 full lengthDepositorInsertintegrin alpha5 full length (ITGA5 Human)
TagsCD33 secretion peptide (MPLLLLLPLLWAGALA) and St…ExpressionMammalianAvailable SinceJuly 15, 2024AvailabilityAcademic Institutions and Nonprofits only