We narrowed to 13,831 results for: sequence
-
Plasmid#179262PurposeLight-induced clustering of EGFR cytosolic domainsDepositorInsertEGFR (EGFR Human)
UseLentiviralTagsCry2 PHR, FUS, FusionRed, and Myristoylation sequ…PromoterSFFVAvailable SinceFeb. 22, 2022AvailabilityAcademic Institutions and Nonprofits only -
-
pFS_1142_pET30_pCat-tetR-Term-ptetA-FsRT-Cas1(opt)-Cas2(opt)-3xTerm_J23103-Leader1-ARRAY1-DR1-FaqI_Term_NotI
Plasmid#184742Purposeencodes aTc inducible FsRT-Cas1–Cas2 expression cassette and FsCRISPR Array 1 transcribed by BBa_J23103DepositorInsertFsRT-Cas1(opt)-Cas2(opt)
ExpressionBacterialMutationsequence codon optimized for expression in E. coliPromoterpTetAAvailable SinceMay 13, 2022AvailabilityAcademic Institutions and Nonprofits only -
Human_TFAM_NoMTS_L6_pET28a+
Plasmid#60012PurposeExpresses TFAM No MTS L6 mutant in bacterial cellsDepositorInsertHuman TFAM No MTS (TFAM Human)
Tags6xHisExpressionBacterialMutationMissing 1st 42 aas (Mitochondrial targeting seque…PromoterT7Available SinceOct. 21, 2014AvailabilityAcademic Institutions and Nonprofits only -
pSP6-RNAP
Plasmid#48143PurposeShuttle vector E. coli/B.meg.; encoding the RNA polymerase of the phage SP6 under control of the xylose inducible promoter PxylADepositorInsertrna polymerase SP6
UseSynthetic BiologyExpressionBacterialMutationV314A (numbering based on NCBI Sequence ID: NP_85…Available SinceOct. 21, 2013AvailabilityAcademic Institutions and Nonprofits only -
pKlab810-bGlobin_3xFLAG-BRCA1(full-length)
Plasmid#249023PurposeThis plasmid expresses the full length BRCA1 sequence with an N-terminal 3xFLAG tagDepositorAvailable SinceJan. 21, 2026AvailabilityAcademic Institutions and Nonprofits only -
pENTR-AtTAS1c-D2-B/c
Plasmid#137883PurposeGateway-compatible entry vector for direct cloning of synthetic trans-acting siRNAs into Arabidopsis thaliana TAS1c precursor at position downstream 3'D1[+]DepositorInsertAtTAS1c-D2-B/c
UseGateway-compatible entry cloneMutationA. thaliana TAS1c precursor sequence including a …Available SinceMay 14, 2020AvailabilityAcademic Institutions and Nonprofits only -
pPPED
Plasmid#162468PurposeDestination Expression vector for dicot plant prime editingDepositorInsertsCas9H840A
attR gateway destination cassette
TagsMLV reverse transcriptaseExpressionPlantMutationChange histidine 840 to Alanine based sequence o…Promoter2x35SAvailable SinceDec. 17, 2021AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1(+)-HLA-Flag-natT1R3
Plasmid#113950Purposemammalian expression plasmid for FLAG-tagged human T1R3 with signal peptide of HLA class I histocompatibility antigen A-2 alpha chainDepositorInsertT1R3 (TAS1R3 Human)
TagsFLAG and Signal/leader sequence from HLA class I …ExpressionMammalianMutationresidues 21-852Available SinceFeb. 8, 2019AvailabilityAcademic Institutions and Nonprofits only -
pLVX-TetOne-Puro-EcSTH-FLAG
Plasmid#218628PurposeThis plasmid contains human codon optimized sequence of EcSTH which is a soluble transhydrogenase from E. coli that can be used to increase NADH/NAD+ ratio in mammalian cells.DepositorInsertEcSTH
UseLentiviral and Synthetic BiologyTagsFLAGExpressionMammalianAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
pT2K-CAGGS-U6-sgRNA-M5-U6-sgRNA-M7-U6-sgRNA-M9-IRES-CFP
Plasmid#114729Purpose3 sgRNAs targeting a sequence upstream of the initiator ATG of the cellular Myc geneDepositorInsertsgRNA M5, sgRNA M7, sgRNA M9
UseCRISPRExpressionMammalianAvailable SinceSept. 18, 2018AvailabilityAcademic Institutions and Nonprofits only -
pLVX-TetOne-Puro-mitoEcSTH-FLAG
Plasmid#218629PurposeThis plasmid contains human codon optimized sequence of mitoEcSTH which is a soluble transhydrogenase from E. coli that can be used to increase NADH/NAD+ ratio in mammalian cells.DepositorInsertmitoEcSTH
UseLentiviral and Synthetic BiologyTagsFLAG and MTSExpressionMammalianAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
pTT3 Unc5D-FLAG
Plasmid#72197PurposeExpresses full-length Unc5d with a C-terminal FLAG tagDepositorAvailable SinceMay 30, 2018AvailabilityAcademic Institutions and Nonprofits only -
hZMPSTE24-3FLAG_pQCXIP
Plasmid#89759PurposeHuman ZMPSTE24 mammalian expression vector. Retroviral bicistronic puromycin vector.DepositorInsertHomo sapiens zinc metallopeptidase STE24 (ZMPSTE24) (ZMPSTE24 Human)
UseRetroviral; Bicistronic expression: puromycin re…Tags9bp spacer (NotI site) - 3xFLAG epitopes - Stop c…ExpressionMammalianMutationY253H in ZMPSTE24 (see depositor comments below)PromoterCMVAvailable SinceJune 8, 2017AvailabilityAcademic Institutions and Nonprofits only -
pWMD23
Plasmid#140006PurposeExpression of ORF1 (Shuffle 1 NLS) and Pong TPase (L418A, L420A)DepositorInsertsORF1 Shuffle 1 NLS
Pong TPase LA
ExpressionPlantMutationNES sequence mutated L418A, L420A and Ping N-term…Available SinceJan. 20, 2021AvailabilityAcademic Institutions and Nonprofits only -
scADGFP
Plasmid#114434PurposeEpilepsy promoter enhanced with Arc elements driving GFP with SV40E polyADepositorInsertGreen fluorescent protein
UseAAVTagsER export sequence FCYENEVExpressionMammalianPromoterNovel synthetic activity-dependent promoterAvailable SinceSept. 25, 2023AvailabilityAcademic Institutions and Nonprofits only -
pAAV-hSynapsin- soCoChR-GFP
Plasmid#107708PurposeA somatic channelrhodopsin, which enables single cell, single millisecond resolution optogenetics. Human Synapsin (hSynapsin) promoterDepositorHas ServiceAAV9InsertsoCoChR-GFP
UseAAVTagsEGFP and KA2ExpressionMammalianPromoterhSynapsinAvailable SinceApril 30, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-PM-TORCAR
Plasmid#64930PurposePlasma membrane-targeted FRET biosensor for monitoring mTORC1 kinase activity.DepositorInsertLyn-TORCAR (EIF4EBP1 Human, Synthetic)
TagsCerulean, N-terminal targeting sequence from Lyn …ExpressionMammalianPromoterCMVAvailable SinceMay 22, 2015AvailabilityAcademic Institutions and Nonprofits only -
pBXNPHM3
Plasmid#110099PurposeE.coli expression vector for FX cloning system, N-terminal pelB signal sequence followed by 10xHisTag, maltose binding protein and 3C cleavage siteDepositorTypeEmpty backboneTagsHisExpressionBacterialAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only