We narrowed to 30,828 results for: REP
-
Plasmid#31330DepositorAvailable SinceMarch 22, 2013AvailabilityAcademic Institutions and Nonprofits only
-
pStreptagII 3C EGFR EABR
Plasmid#234994PurposeFor production of Extracellular Vesicles (EVs), with Epithelial Growth Factor Receptor on their surface, Strep-tag II labeled on its N-terminusDepositorAvailable SinceApril 15, 2025AvailabilityAcademic Institutions and Nonprofits only -
NFAT luciferase reporter
Plasmid#10959DepositorAvailable SinceJan. 6, 2006AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-2strep-FBH1
Plasmid#236464Purposetransient overexpression of FBH1 in mammalian cellsDepositorInsertFBH1 (FBXO18 Human)
ExpressionMammalianAvailable SinceMay 21, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
AAV-PR rep/cap
Plasmid#197565Purposeencodes AAV-PR capsid that transduces pericytes and smooth muscle cells in mice after systemic deliveryDepositorInsertsAAV Rep genes
AAV9 VP1 Cap gene with PR insert
UseAAVMutationcontains 7mer insert PRPPSTH between amino acids …Available SinceJune 12, 2023AvailabilityAcademic Institutions and Nonprofits only -
pSHDY*in_PpetE:BCD2:MrBBS:Strep
Plasmid#133973PurposeHeterologous, copper-inducible expression of (-)-α- bisabolol synthase from Matricaria recutita (MrBBS) in Synechocystis sp. PCC 6803. The MrBBS CDS is fused to a C-termial StrepII-tag.DepositorInsertMrBBS:StrepII
UseSynthetic BiologyTagsStrepIIExpressionBacterialMutationinserted gene is codon optimized for Synechocyst…PromoterPpetE:BCD2Available SinceApril 6, 2020AvailabilityAcademic Institutions and Nonprofits only -
GAL4UAS-Luciferase reporter
Plasmid#64125PurposePhotoactivatable transcription system. Luciferase reporter under the control of the upstream activator sequence (UAS) of Gal4.DepositorInsertGAL4UAS
UseLuciferaseTagsluciferaseExpressionMammalianPromoterGAL4UASAvailable SinceApril 15, 2015AvailabilityAcademic Institutions and Nonprofits only -
4XCLEAR-luciferase reporter
Plasmid#66800PurposeReporter for activity of the CLEAR networkDepositorInsert4XCLEAR
UseLuciferasePromoterFour CLEAR elements (GTCACGTGAC) in tandem derive…Available SinceNov. 5, 2015AvailabilityAcademic Institutions and Nonprofits only -
TwinStrepSUMO-pvc10-Cas9
Plasmid#243755PurposeFor affinity purification of Pvc10 fused to Cas9DepositorInsertpvc10-Cas9
ExpressionBacterialAvailable SinceSept. 24, 2025AvailabilityAcademic Institutions and Nonprofits only -
CFP_ betaGlobin_24XPP7_24XMS2_Splicing_ reporter
Plasmid#61762PurposeDual Color betaGlobin reporter to study splicing kinetics in vivoDepositorInsertb-Globin
Tags24 X MS2 hairpin cassette in 3'UTR of b-Glob…ExpressionMammalianPromoterDox inducible Tet-ON promoterAvailable SinceFeb. 12, 2015AvailabilityAcademic Institutions and Nonprofits only -
pAB2076 pAAV REPAIR.t1
Plasmid#176323PurposepAAV EFS-HIVNES-dCas13bt1- (GGS)2-huADAR2(E488Q)-3xHA BGHpolyA::U6-BpiI-Cas13bt1 DR (full REPAIR.t1 + crRNA expression for AAV production)DepositorInsertshuman codon optimized Cas13bt1 (catalytically inactivated)
huADAR2dd(E488Q) (ADARB1 Human)
Cas13bt1 crRNA + BpiI cloning site
UseAAV and CRISPRTags3xHA and HIV NESExpressionMammalianMutationE488Q, only the deaminase domain (aa 276-702 are …PromoterEFS (short EF1alpha) and hU6Available SinceOct. 14, 2021AvailabilityAcademic Institutions and Nonprofits only -
pET21a-Streptavidin-Alive
Plasmid#20860PurposeAlive subunit for creating monovalent streptavidin with a single femtomolar biotin binding site. Can also be used to create wild-type (tetravalent) streptavidin.DepositorInsertStreptavidin-Alive
TagsHisExpressionBacterialMutationWt geneAvailable SinceApril 21, 2009AvailabilityAcademic Institutions and Nonprofits only -
SRE reporter vector_559
Plasmid#82686PurposeCloning vector containing serum response element (SRE) followed by an AscI restriction siteDepositorTypeEmpty backboneExpressionMammalianAvailable SinceNov. 2, 2016AvailabilityAcademic Institutions and Nonprofits only -
pET21a-Streptavidin-Dead
Plasmid#20859PurposeDead subunit for creating monovalent streptavidin with a single femtomolar biotin binding site. Use in combination with Streptavidin-Alive (construct 20860).DepositorInsertStreptavidin-Dead
ExpressionBacterialMutationTriple mutant of wt Streptavidin N23A,S27D,S45AAvailable SinceApril 21, 2009AvailabilityAcademic Institutions and Nonprofits only -
Annexin A7-TEV-TwinStrep
Plasmid#198635PurposeAnnexin A7 fibrillization and lipid bindingDepositorAvailable SinceSept. 29, 2023AvailabilityAcademic Institutions and Nonprofits only -
pET21-Streptavidin-K121R
Plasmid#89880PurposeStreptavidin that has unimpaired biotin binding after dye labelingDepositorInsertStreptavidin-K121R-Glutamate_Tag
Tags6 glutamate tag (C terminal on insert)ExpressionBacterialMutationK121RAvailable SinceAug. 9, 2017AvailabilityAcademic Institutions and Nonprofits only -
pnCS_SEPT7_SEPT9_i1-TEV-Strep
Plasmid#174500Purposebacterial co-expression of human SEPT7 and of human SEPT9_i1DepositorAvailable SinceSept. 29, 2021AvailabilityAcademic Institutions and Nonprofits only -
pTwist-CMV-HDGFL2_Cryptic_TwinstrepTEV_6xHis
Plasmid#232344PurposeExpresses human HDGFL2 protein with TDP-43 regulated cryptic exon, along with an N-terminal twinstrep tag + TEV protease site and C-terminal His-tagDepositorInsertHDGF Like 2 (HDGFL2 Human)
TagsGGGS linker, 6xHis and Twin-strep, TEV protease s…ExpressionMammalianMutationTDP-43 regulated cryptic exonAvailable SinceFeb. 21, 2025AvailabilityAcademic Institutions and Nonprofits only -
Dead Streptavidin-SpyTag
Plasmid#59548PurposepET21-DTag encodes Dead streptavidin (negligible biotin binding) bearing a C-terminal SpyTag, for generation of chimeric SpyAvidin tetramersDepositorInsertDead Streptavidin-SpyTag
TagsSpyTagExpressionBacterialMutationThe construct lacks final K of SpyTagPromoterT7Available SinceOct. 3, 2014AvailabilityAcademic Institutions and Nonprofits only