We narrowed to 84,739 results for: MYC
-
Plasmid#64289PurposeKIF13A aa 442-1826 with N-terminal FRB and triple myc tagsDepositorInsertKIF13B (Kif13b Mouse)
Tags3myc and FRBExpressionMammalianMutationaa 442-1826Promoterchicken Beta ActinAvailable sinceJuly 14, 2015AvailabilityAcademic Institutions and Nonprofits onlyCited by -
Man1B1-Myc
Plasmid#163645PurposeExpresses myc tagged Man1B1 in mammalian cellsDepositorAvailable sinceNov. 24, 2021AvailabilityAcademic Institutions and Nonprofits only -
pCEP4-SERTG56A -myc
Plasmid#107459PurposeMammalian expression plasmid for codon optimized mutant hSERT with internal MYC tag inserted in ECL2, mutation G56A conferring wildtype phenotypeDepositorPublicationAvailable sinceMarch 14, 2018AvailabilityAcademic Institutions and Nonprofits only -
pRK5-Myc-SAMTOR
Plasmid#100517PurposeExpresses Myc tagged SAMTOR in mammalian cellsDepositorPublicationAvailable sinceNov. 10, 2017AvailabilityAcademic Institutions and Nonprofits only -
pLPC myc-mRAP1
Plasmid#73136PurposeExpression of myc-tagged mRAP1DepositorAvailable sinceFeb. 12, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCEP4-myc-HLA-B8
Plasmid#135512PurposeMammalian expression of myc-tagged HLA-B*08:01DepositorInsertHLA-B*08:01 (HLA-B Human)
TagsExtracellular c-myc epitope tag and Signal peptid…ExpressionMammalianPromoterCMVAvailable sinceFeb. 6, 2020AvailabilityAcademic Institutions and Nonprofits only -
myc-UVRAG S498A
Plasmid#86737PurposeN-terminal myc-tagged protein expression in mammalian cellsDepositorAvailable sinceJan. 25, 2017AvailabilityAcademic Institutions and Nonprofits only -
p3E-mKate2-myc no-pA
Plasmid#80812Purposemyc epitope fused to C-terminus of mKate2 without pADepositorInsertmKateHA p3E
ExpressionMammalianAvailable sinceNov. 1, 2016AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pUltra-Exon1Q145-Myc-B
Plasmid#110489PurposeLentiviral vector to express mutant N terminal HTT gene with partial long 3'UTR in mammalian cells (encodes Myc-tagged mutant huntingtin exon1 fragment with 145 repeats of Q)DepositorInsertHomo sapiens huntingtin (HTT Human)
UseLentiviralTagsMycExpressionMammalianMutationpartial long 3'UTR wild type huntingtin exon…PromoterUbCAvailable sinceJuly 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pSBinit
Plasmid#110100PurposeE.coli entry and expression vector for FX cloning system, N-terminal pelB signal sequence and C-terminal myc and 6xHisTagDepositorTypeEmpty backboneTagsmyc, HisExpressionBacterialAvailable sinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable sinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
Myc-Nix-S212D
Plasmid#197515PurposeMammalian expression of myc-tagged human Nix with an aspartic acid substitution of serine-212. Based on Myc-Nix (#100795)DepositorInsertBCL2 interacting protein 3 like (BNIP3L Human)
TagsMycExpressionMammalianMutationSerine 212 changed to aspartic acidPromoterCMVAvailable sinceMarch 2, 2023AvailabilityAcademic Institutions and Nonprofits only -
Myc-Nix-S212A
Plasmid#197514PurposeMammalian expression of myc-tagged human Nix with an alanine substitution of serine-212. Based on Myc-Nix (#100795)DepositorInsertBCL2 interacting protein 3 like (BNIP3L Human)
TagsMycExpressionMammalianMutationSerine 212 changed to alaninePromoterCMVAvailable sinceMarch 1, 2023AvailabilityAcademic Institutions and Nonprofits only -
pUG-412
Plasmid#104638PurposeLevel 2 constructDepositorInsertHIS-Ubq_UBA1_HA-UBC8_GST-AvrPtoB_Myc-Fen_EL5
TagsHIS-Ubq, HA-E2, GST-E3ExpressionBacterialPromoterT7Available sinceFeb. 1, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1(+)-HLA-cmyc-natT1R2
Plasmid#113946Purposemammalian expression plasmid for c-myc-tagged human T1R2 with signal peptide of HLA class I histocompatibility antigen A-2 alpha chainDepositorInsertT1R2 (TAS1R2 Human)
TagsSignal/leader sequence from HLA class I histocomp…ExpressionMammalianMutationresidues 22-839Available sinceFeb. 8, 2019AvailabilityAcademic Institutions and Nonprofits only -
pBa-FRB-3myc-KIF1B beta tail 387-1770
Plasmid#64287PurposeKIF1B beta aa 387-1770 with N-terminal FRB and triple myc tagsDepositorInsertKIF1B beta (Kif1b Mouse, Rat)
Tags3myc and FRBExpressionMammalianMutationaa 387-1770, small portion of 5'end matches …Promoterchicken Beta ActinAvailable sinceJuly 22, 2015AvailabilityAcademic Institutions and Nonprofits onlyCited by -
PB-TRE-OKSM
Plasmid#204498PurposeExpresses Oct4, Klf4, Sox2 and c-Myc by tet-on promoter in mammalian cellsDepositorAvailable sinceFeb. 9, 2024AvailabilityAcademic Institutions and Nonprofits only -
pGEX-4T-1-3xMyc-ERK2(K52R)
Plasmid#129228PurposeEncodes Myc tagged human ERK2(K52R) for purification by GST affinityDepositorInsertERK2(K52R) (Mapk1 Rat)
TagsGST and MycExpressionBacterialMutationChanged Lysine 52 to ArginineAvailable sinceJan. 21, 2020AvailabilityAcademic Institutions and Nonprofits only -
pCEP4-myc-HLA-B57
Plasmid#135516PurposeMammalian expression of myc-tagged HLA-B*57:01DepositorInsertHLA-B*57:1 (HLA-B Human)
TagsExtracellular c-myc epitope tag and Signal peptid…ExpressionMammalianPromoterCMVAvailable sinceFeb. 6, 2020AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-N-Myc_1-205 USP7
Plasmid#131245PurposeMammalian expression of the USP7 TRAF-like domain with an N-terminal Myc tag.DepositorInsertUbiquitin carboxyl-terminal hydrolase 7 (USP7 Human)
TagsMycExpressionMammalianMutationExpresses a mutant form of our pcDNA3.1-N-Myc_1-5…Available sinceDec. 17, 2020AvailabilityAcademic Institutions and Nonprofits only