270,825 results
-
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pgLAP4
Plasmid#19705DepositorInsertpgLAP4
TagsFlag, S peptide, and TevExpressionMammalianAvailable SinceApril 14, 2009AvailabilityAcademic Institutions and Nonprofits only -
pgLAP4
Plasmid#19705DepositorInsertpgLAP4
TagsFlag, S peptide, and TevExpressionMammalianAvailable SinceApril 14, 2009AvailabilityAcademic Institutions and Nonprofits only -
ER-B
Plasmid#209870PurposeDimerization dependent fluorescent protein B anchored to cytosolic face of the endoplasmic reticulum membrane with N-terminal targeting sequence of rabbit CYP2C1DepositorInsertddGFP B
TagsTargeting domain of CYP2C1 MDPVVVLGLCLSCLLLLSLWKQ…ExpressionMammalianPromoterCMVAvailable SinceNov. 20, 2023AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-N1-MITF-M
Plasmid#38131DepositorAvailable SinceJuly 17, 2012AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-N1-MITF-M
Plasmid#38131DepositorAvailable SinceJuly 17, 2012AvailabilityAcademic Institutions and Nonprofits only -
CMVTO-SEAP-26Sfur-3TM-tevs-AAMP
Plasmid#179633PurposeSEAP RELEASE construct with AAMP motif controlDepositorInsertSEAP RELEASE
ExpressionMammalianAvailable SinceMarch 23, 2022AvailabilityAcademic Institutions and Nonprofits only -
pH2B-Electra2
Plasmid#179479PurposeNuclear labeling with blue fluorescent protein Electra2 fused to H2BDepositorInsertH2B-Electra2
TagsElectra2ExpressionMammalianPromoterCMVAvailable SinceAug. 10, 2022AvailabilityAcademic Institutions and Nonprofits only -
pAAV-ihSyn1-tTA
Plasmid#99120PurposeAn AAV genome that expresses tTA from the hSyn1 promoter that contains a positive feedback loop for amplifed expression of the tTADepositorHas ServiceAAV1InserttTA
UseAAVExpressionMammalianMutation*(see below)PromoterihSyn1Available SinceAug. 15, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAAV-ihSyn1-tTA
Plasmid#99120PurposeAn AAV genome that expresses tTA from the hSyn1 promoter that contains a positive feedback loop for amplifed expression of the tTADepositorHas ServiceAAV1InserttTA
UseAAVExpressionMammalianMutation*(see below)PromoterihSyn1Available SinceAug. 15, 2017AvailabilityAcademic Institutions and Nonprofits only -
TFORF1842
Plasmid#143324PurposeLentiviral vector for overexpressing transcription factor ORFs with unique 24-bp barcodes. Barcodes facilitate identification of transcription factors in pooled screens.DepositorAvailable SinceJuly 11, 2023AvailabilityAcademic Institutions and Nonprofits only -
TFORF1842
Plasmid#143324PurposeLentiviral vector for overexpressing transcription factor ORFs with unique 24-bp barcodes. Barcodes facilitate identification of transcription factors in pooled screens.DepositorAvailable SinceJuly 11, 2023AvailabilityAcademic Institutions and Nonprofits only -
pDONR223-TLK2
Plasmid#23629DepositorInsertTLK2 (TLK2 Human)
UseGateway donor vectorAvailable SinceJuly 30, 2010AvailabilityAcademic Institutions and Nonprofits only -
pDONR223-TLK2
Plasmid#23629DepositorInsertTLK2 (TLK2 Human)
UseGateway donor vectorAvailable SinceJuly 30, 2010AvailabilityAcademic Institutions and Nonprofits only -
TLCV2-RB1
Plasmid#87836PurposeLentiCRISPR v2 was modified into an all-in-one dox inducible system. The addition of doxycycline induces Cas9-2A-eGFP. The U6 promoter drives constitutive expression of an sgRNA targeting human RB1.DepositorInsertsgRB1 (RB1 Human)
UseCRISPR and Lentiviral; Doxycycline inducible; egf…ExpressionMammalianPromoterTight TRE promoter and U6Available SinceApril 12, 2017AvailabilityAcademic Institutions and Nonprofits only -
TLCV2-RB1
Plasmid#87836PurposeLentiCRISPR v2 was modified into an all-in-one dox inducible system. The addition of doxycycline induces Cas9-2A-eGFP. The U6 promoter drives constitutive expression of an sgRNA targeting human RB1.DepositorInsertsgRB1 (RB1 Human)
UseCRISPR and Lentiviral; Doxycycline inducible; egf…ExpressionMammalianPromoterTight TRE promoter and U6Available SinceApril 12, 2017AvailabilityAcademic Institutions and Nonprofits only -
pMBP-FnCas12a
Plasmid#113432PurposeExpresses 10xHis-MBP fused to FnCas12aDepositorInsertFnCas12a
TagsMBPExpressionBacterialPromoterT7Available SinceAug. 1, 2018AvailabilityAcademic Institutions and Nonprofits only -
pMBP-FnCas12a
Plasmid#113432PurposeExpresses 10xHis-MBP fused to FnCas12aDepositorInsertFnCas12a
TagsMBPExpressionBacterialPromoterT7Available SinceAug. 1, 2018AvailabilityAcademic Institutions and Nonprofits only -
pET31b-T7-Spinach2-Ct
Plasmid#79158PurposeExpresses the Ct biosensor under a T7 promoterDepositorInsertT7-tRNA-Spinach2-Ct
ExpressionBacterialPromoterT7Available SinceAug. 12, 2016AvailabilityAcademic Institutions and Nonprofits only -
pET31b-T7-Spinach2-Ct
Plasmid#79158PurposeExpresses the Ct biosensor under a T7 promoterDepositorInsertT7-tRNA-Spinach2-Ct
ExpressionBacterialPromoterT7Available SinceAug. 12, 2016AvailabilityAcademic Institutions and Nonprofits only