We narrowed to 43,830 results for: Ina;
-
Plasmid#12779PurposeThis plasmid was designed for screening purposes and may contain discrepancies relative to the current canonical GenBank version of the gene.DepositorInsertVV.Orf91
ExpressionMammalianAvailable SinceDec. 6, 2006AvailabilityAcademic Institutions and Nonprofits only -
DCT.VV.Orf34
Plasmid#12722PurposeThis plasmid was designed for screening purposes and may contain discrepancies relative to the current canonical GenBank version of the gene.DepositorInsertVV.Orf34
ExpressionMammalianAvailable SinceDec. 1, 2006AvailabilityAcademic Institutions and Nonprofits only -
pNP3386 [For use in genome insertion and off-target assessment]
Plasmid#247258PurposeExample plasmid for bridge recombinase mediated insertion and off-target assessment with puromycin selection — must clone in UMIDepositorInsertISCro4 Recognition Site-UMI-Ef1a-PuroR-P2A-mCherry (Plasmid for Insertion Site Mapping [Example, Clone in Sequence + UMI])
ExpressionMammalianAvailable SinceOct. 23, 2025AvailabilityAcademic Institutions and Nonprofits only -
7M8
Plasmid#64839PurposeThis plasmid can be used in the triple transfection method of AAV vector production. It supplies the replication proteins from AAV2 and the 7M8 capsid protein.DepositorInsert7M8 cap
UseAAVMutation7mer insertion in the AAV2 capAvailable SinceAug. 3, 2015AvailabilityAcademic Institutions and Nonprofits only -
pFB1.HMBP.PrS.PHF19
Plasmid#125168PurposeExpresses human PHF19 in insect cells, , under a C3-cleavable (PreScission Protease) N-terminal hexahistidine-MBP tag.DepositorAvailable SinceApril 27, 2020AvailabilityAcademic Institutions and Nonprofits only -
pAAV-TPH2-Cre
Plasmid#189616PurposeExpresses Cre recombinase under the control of the tryptophan hydroxylase promoterDepositorInsertCre Recombinase
UseAAVExpressionMammalianPromoterTph2Available SinceMarch 15, 2023AvailabilityAcademic Institutions and Nonprofits only -
pUCmini-iCAP-PHP.eB
Plasmid#103005Purposenon-standard AAV2 rep-AAV-PHP.eB cap plasmid with AAV cap expression controlled by a tTA-TRE amplification systemDepositorInsertSynthetic construct isolate AAV-PHP.eB VP1 gene
UseAAVExpressionMammalianPromoterp41Available SinceMarch 29, 2018AvailabilityAcademic Institutions and Nonprofits only -
pTwist-SFFV-NFE2L18ND-Puro
Plasmid#181918PurposeLentiviral plasmid that directs the expression of mutant NFE2L1/Nrf1 where 8 putative N-glycosites are mutated from asparagine to aspartic acid in mammalian cells.DepositorInsertNFE2L1 (NFE2L1 Human)
UseLentiviralTagsFLAG and HAExpressionMammalianMutation8 putative N-glycoyslation sites converted from a…PromoterSFFVAvailable SinceApril 6, 2022AvailabilityAcademic Institutions and Nonprofits only -
pT7-hMLH1dn for IVT
Plasmid#178114PurposeTemplate for in vitro transcription of human MLH1dnDepositorInserthuman MLH1dn (codon optimized) (MLH1 Human)
UseTemplate for in vitro transcriptionMutationDetailed in manuscriptPromoterT7 (inactivated)Available SinceNov. 30, 2021AvailabilityAcademic Institutions and Nonprofits only -
pMSCV mKeima-LC3
Plasmid#189006PurposeFluorescent reporter for autophagyDepositorInsertmKeima, LC3 (Map1lc3b Rat)
UseRetroviralAvailable SinceSept. 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pORTMAGE-4
Plasmid#72679PurposeExpresses Lambda Red recombinases and a dominant negative MutL allele all controlled by temperature sensitve cI857 repressor for high precision and efficiency MAGE experiments. Cam resistance marker.DepositorInsertmutL E32K
TagsnoneExpressionBacterialMutationE32K mutation conferring dominant mutator phenoty…Available SinceFeb. 18, 2016AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-HaloTag-Puromycin
Plasmid#167208PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with HaloTag and selection with PuromycinDepositorTypeEmpty backboneUseCRISPRTagsHaloTagExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pTT3 Unc5D-FLAG
Plasmid#72197PurposeExpresses full-length Unc5d with a C-terminal FLAG tagDepositorAvailable SinceMay 30, 2018AvailabilityAcademic Institutions and Nonprofits only -
pIVT_goldDn29-dCas9-P2A-GFP
Plasmid#247167PurposeIn vitro transcription of human codon optimized fusion of goldDn29-dCas9-P2A-GFPDepositorInsertgoldDn29-dCas9-P2A-GFP
UseIn vitro transcriptionTagsSV40 NLSMutationM6I/E70G/A224P/G227V/Q332K/N341K/L393P/D503NPromotermutated T7Available SinceNov. 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
pUCmini-iCAP-PHP.S
Plasmid#103006Purposenon-standard AAV2 rep-AAV-PHP.S cap plasmid with AAV cap expression controlled by a tTA-TRE amplification systemDepositorInsertSynthetic construct isolate AAV-PHP.S VP1 gene
UseAAVExpressionMammalianPromoterp41Available SinceFeb. 7, 2018AvailabilityAcademic Institutions and Nonprofits only -
pLenti-mCherry-Cre-blast
Plasmid#179390PurposeLentiviral expression of Cre recombinase and mCherry reporter from CMV promoter (separated by P2A peptide), and blasticidin resistance gene for selection in mammalian cells.DepositorInsertmCherry (P2A) Cre recombinase
UseCre/Lox and LentiviralExpressionMammalianPromoterCMVAvailable SinceFeb. 22, 2022AvailabilityAcademic Institutions and Nonprofits only -
pAAV.cTNT.iCre
Plasmid#69916PurposeUsed to package AAV9:cTNT.iCre, which specifically transduce cardiomyocytes and express Cre recombinase. Only works in vivo.DepositorHas ServiceAAV9Insertimproved cre (iCre) recombinase and tdTomato
UseAAVTagsThe iCre coding frame and tdTomato coding frame i…PromoterChicken cardiac troponin TAvailable SinceDec. 14, 2015AvailabilityAcademic Institutions and Nonprofits only -
ABE8.20-m
Plasmid#136300Purposeexpresses ABE8.20-m in mammalian cellsDepositorInsertABE8.20-m
TagsC-terminal BPNLSExpressionMammalianMutationD10A in S. pyogenes Cas9, TadA mutations describe…Available SinceMarch 16, 2020AvailabilityAcademic Institutions and Nonprofits only -
pLenti-CMV-NFE2L2-Puro
Plasmid#181919PurposeLentiviral plasmid that directs the expression of NFE2L2/Nrf2 in mammalian cells.DepositorAvailable SinceApril 15, 2022AvailabilityAcademic Institutions and Nonprofits only -
ABE8.8-m
Plasmid#136294Purposeexpresses ABE8.8-m in mammalian cellsDepositorInsertABE8.8-m
TagsC-terminal BPNLSExpressionMammalianMutationD10A in S. pyogenes Cas9, TadA mutations describe…Available SinceMarch 16, 2020AvailabilityAcademic Institutions and Nonprofits only -
pSPIH6
Plasmid#190676PurposeE. coli plasmid for single step cloning of SUMO-peptide-intein (SPI) fusion proteins (contains SUMO and His-tagged intein)DepositorInsertsSmall ubiquitin-like modifier
Mxe GyrA intein with C-terminal chitin binding domain and His tag
TagsChitin binding domain, His tag, and N-terminal Hi…ExpressionBacterialMutationAdded C-terminal his tag and NonePromoterT7Available SinceFeb. 21, 2023AvailabilityAcademic Institutions and Nonprofits only -
LentiV_Neo_SIK3_CR_K95M
Plasmid#108106PurposeLentiviral expression plasmid of human SIK3 cDNA (CRISPR-resistant silent mutation & kinase-dead mutation) with neomycin resistance geneDepositorInsertSIK3 (SIK3 Human)
UseCRISPR and LentiviralExpressionMammalianMutationchange guanine 501 to cytosine (silent mutation),…PromoterEFS promoterAvailable SinceApril 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
pPW3758 : CMVd3-HsIRE1-HaloTag
Plasmid#185680PurposeLow-level transient expression of full-length HsIRE1 with a C-terminal HaloTag.DepositorInsertERN1 (ERN1 Human, Synthetic)
ExpressionMammalianAvailable SinceMarch 14, 2023AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-NanoLuc-Puromycin
Plasmid#167209PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with NanoLuc and selection with PuromycinDepositorTypeEmpty backboneUseCRISPRTagsNanoLucExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pUCmini-iCAP-PHP.B
Plasmid#103002Purposenon-standard AAV2 rep-AAV-PHP.B cap plasmid with AAV cap expression controlled by a tTA-TRE amplification systemDepositorInsertSynthetic construct isolate AAV-PHP.B VP1 gene
UseAAVExpressionMammalianPromoterp41Available SinceFeb. 7, 2018AvailabilityAcademic Institutions and Nonprofits only -
pKrox24(MapErk)DsRed
Plasmid#200114PurposeFluorescent reporter for in cell monitoring of receptor tyrosine kinase-MAP ERK pathway activityDepositorInsertMapErk sequence in minimal promoter
ExpressionMammalianMutationhighly modified sequencePromoter5 copies of designed MapErk sequence, no other pr…Available SinceJune 14, 2023AvailabilityAcademic Institutions and Nonprofits only -
pORTMAGE-3
Plasmid#72678PurposeExpresses Lambda Red recombinases and a dominant negative MutL allele all controlled by temperature sensitve cI857 repressor for high precision and efficiency MAGE experiments. Kan resistance marker.DepositorInsertmutL E32K
TagsnoneExpressionBacterialMutationE32K mutation conferring dominant mutator phenoty…Available SinceFeb. 18, 2016AvailabilityAcademic Institutions and Nonprofits only -
pLentiPGK Puro DEST ERKKTRClover
Plasmid#90227PurposeLentiviral vector to express ERK KTR mClover under PGK promoter (With Puromycin Resistance)DepositorInsertERK Kinase Translocation Reporter
UseLentiviralTagsmCloverExpressionMammalianPromoterPGKAvailable SinceMarch 17, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1(+) Flag-His-ATM kd
Plasmid#31986DepositorInsertATM kd (ATM Human)
TagsFlag and HisExpressionMammalianMutation3'UTRf 9 nucl/D2870A N2875k. catalytically …Available SinceMarch 12, 2012AvailabilityAcademic Institutions and Nonprofits only -
Sema6a.a-Fc-His
Plasmid#72163PurposeExpresses the extracellular region of the Sema6A, isoform a protein, C-terminally fused to the Fc region of human IgG1 + 6X histidine tag.DepositorAvailable SinceFeb. 29, 2016AvailabilityAcademic Institutions and Nonprofits only -
CIBN-CAAX
Plasmid#79574Purposeexpression of N-terminal portion of CIB1 with a C-terminal CAAX box from KRras for plasma-membrane targetingDepositorInsertCIBN (CIB1 Mustard Weed)
TagsC-terminal CAAX-boxExpressionMammalianMutationK93A, R94A, K106A, K107A (please see depositor co…PromoterCMVAvailable SinceJuly 29, 2016AvailabilityAcademic Institutions and Nonprofits only -
pMpGWB337
Plasmid#68061PurposeGateway-based vector for Marchantia polymorpha to express a floxed gene, with an expression cassette for Cre-glucocorticoid receptor fusion protein under the control of heat-inducible promoterDepositorTypeEmpty backboneUseCre/LoxExpressionPlantPromoterMpEF1alpha promoterAvailable SinceSept. 18, 2015AvailabilityAcademic Institutions and Nonprofits only -
pENTR-ERKKTRClover
Plasmid#59138PurposeORF encoding ERK KTR mClover flanked by Gateway sequencesDepositorInsertERK Kinase Translocation Reporter (MAPK1 Human, Mouse)
Available SinceSept. 3, 2014AvailabilityAcademic Institutions and Nonprofits only -
pLentiPGK Blast DEST ERKKTRmRuby2
Plasmid#90231PurposeLentiviral vector to express ERK KTR mRuby2 under PGK promoter (With Blasticidin Resistance)DepositorInsertERK Kinase Translocation Reporter
UseLentiviralTagsmRuby2ExpressionMammalianPromoterPGKAvailable SinceMarch 17, 2018AvailabilityAcademic Institutions and Nonprofits only -
pLVX-opto-hCaspase-9
Plasmid#208787PurposeInducibly expresses human Caspase 8 fused to light-activatable Cry2DepositorAvailable SinceNov. 2, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCMV3flag8HOIL-1L
Plasmid#50016PurposeMammalian expression of human HOIL-1L (RBCK1) with a c-terminal 3xFLAG tag, and hygromycin selection.DepositorInsertRanBP-type and C3HC4-type zinc finger containing 1 HOIL-1L (RBCK1 Human)
Tags3 x FLAGExpressionMammalianPromoterCMVAvailable SinceDec. 31, 2013AvailabilityAcademic Institutions and Nonprofits only -
ABE8.20-d
Plasmid#136301Purposeexpresses ABE8.20-d in mammalian cellsDepositorInsertABE8.20-d
TagsC-terminal BPNLSExpressionMammalianMutationD10A in S. pyogenes Cas9, TadA mutations describe…PromoterCMVAvailable SinceMarch 16, 2020AvailabilityAcademic Institutions and Nonprofits only -
pORTMAGE-2
Plasmid#72677PurposeExpresses Lambda Red recombinases and a dominant negative MutL allele all controlled by temperature sensitve cI857 repressor for high precision and efficiency MAGE experiments. Ap resistance marker.DepositorInsertmutL E32K
TagsnoneExpressionBacterialMutationE32K mutation conferring dominant mutator phenoty…PromoterpL promoterAvailable SinceFeb. 18, 2016AvailabilityAcademic Institutions and Nonprofits only -
pHLmMBP-10
Plasmid#72348PurposeMammalian expression of secreted N-terminally 8His-tagged mMBP TEV cleavage site-linked fusion proteins with C-terminal 6His-tag/Strep-tag II/HA-tagDepositorTypeEmpty backboneTags6His-tag, 8His-tag, HA-tag, Strep-tag II, and mMB…ExpressionMammalianPromoterCMV enhancer + chicken beta-actin promoterAvailable SinceFeb. 17, 2016AvailabilityAcademic Institutions and Nonprofits only