We narrowed to 59,739 results for: Gene
-
Plasmid#184864PurposepSwap plasmid part containing the T2 sgRNA module for the Swap and Drop recombination system.DepositorInsertlacZalpha,ccdB
ExpressionBacterialAvailable SinceJan. 3, 2023AvailabilityIndustry, Academic Institutions, and Nonprofits -
pSWAP_Entry_T1
Plasmid#184863PurposepSwap plasmid part containing the T1 sgRNA module for the Swap and Drop recombination system.DepositorInsertlacZalpha,ccdB
ExpressionBacterialAvailable SinceJan. 3, 2023AvailabilityIndustry, Academic Institutions, and Nonprofits -
pAB151
Plasmid#101666PurposeOpto-T7RNAP*(563-F1)DepositorInsertOpto-T7RNAP*(563-F1)
UseSynthetic BiologyExpressionBacterialAvailable SinceSept. 15, 2022AvailabilityAcademic Institutions and Nonprofits only -
pG12-Rluc8
Plasmid#170272PurposeRenilla reniformisluciferase (RLuc8) expression in mammlian cells. Reporter plasmid.DepositorInsertRLuc8
ExpressionMammalianPromoter12xUAS with TATA-box minimal promoterAvailable SinceJune 24, 2021AvailabilityAcademic Institutions and Nonprofits only -
pJF143.J3
Plasmid#153028PurposeJ3-mRFP1DepositorInsertJ3-mRFP1
ExpressionBacterialAvailable SinceSept. 1, 2020AvailabilityAcademic Institutions and Nonprofits only -
pgRNA-guideless
Plasmid#129464PurposeDerived from pSCB2-sgRNA. 20 nucleotide binding sequence of sgRNA removed by inverse PCR. Used as a negative control.DepositorInsertGuideless gRNA backbone
UseCRISPRExpressionBacterialPromoterBBa_J23119 (SpeI)Available SinceSept. 30, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCAH01Sp::Cas9D10A
Plasmid#128161PurposePtet-controlled expression of S. pyogenes Cas9D10A variantDepositorInsertSp Cas9
ExpressionBacterialMutationD10APromoterPtetAvailable SinceJuly 15, 2019AvailabilityAcademic Institutions and Nonprofits only -
pN3FS-CYC1
Plasmid#85783PurposeN-ICE plasmid pH3FS-CYC1DepositorInsertloxP-NatMX-loxP-CYC1p-3FLAG
UseCre/LoxExpressionYeastMutation*(see below)Available SinceSept. 28, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCAS9-mCherry-HIST1H4C
Plasmid#66944PurposeCRISPaint target selector HIST1H4CDepositorInsertgRNA HIST1H4C
Available SinceSept. 23, 2016AvailabilityAcademic Institutions and Nonprofits only -
pET15b/bPanK
Plasmid#73619PurposeProduces Escherichia coli pantothenate kinase, with N-terminal His6 tag (H6PanK)DepositorInsertpantothenate kinase (coaA Escherichia coli)
TagsHis6ExpressionBacterialMutationrelative to MG1655 sequence, changes glutamate-5 …PromoterT7Available SinceFeb. 22, 2016AvailabilityAcademic Institutions and Nonprofits only -
Degron-KI SF3B1 donor vector
Plasmid#65622PurposeDonor vector to generate Degron-KI DD-SF3B1DepositorInsertSF3B1 Degron-KI left and right HR arms
Available SinceJune 8, 2015AvailabilityAcademic Institutions and Nonprofits only -
pET28 Set9 mutant
Plasmid#24083DepositorAvailable SinceOct. 27, 2010AvailabilityAcademic Institutions and Nonprofits only -
-
-111 hTF m1
Plasmid#15448DepositorAvailable SinceJuly 27, 2007AvailabilityAcademic Institutions and Nonprofits only -
608 pSG5L HA RB del ex4
Plasmid#10730DepositorAvailable SinceOct. 7, 2005AvailabilityAcademic Institutions and Nonprofits only -
pKD4_mCherry
Plasmid#187386PurposeTo chromosomally tag genes of interest with mCherry. FRT-mCherry-kan-FRTDepositorInsertmCherry
ExpressionBacterialAvailable SinceSept. 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
pHR_PGK_SNIPR_CD8alpha SNIPR
Plasmid#188357PurposeLentiviral vector - constitutive expression of an anti-CD19 SNIPR with a CD8alpha-ECD, a Notch1-TMD, a Notch1-JMD, and a Gal4VP64 transcriptional factorDepositorInsertPGK_antiCD19_CD8alpha-ECD_Notch1-TMD_Notch1-JMD_Gal4VP64
UseLentiviralAvailable SinceMarch 9, 2023AvailabilityAcademic Institutions and Nonprofits only -
L1_lacZgRNA-Ck2
Plasmid#136137PurposeL1 in position 2, to clone gRNA target using BbsI, lacZ blue-white screeningDepositorInsertp5-MpU6:lacZgRNA
UseSynthetic BiologyExpressionPlantMutationBsaI/ SapI domesticatedAvailable SinceNov. 30, 2021AvailabilityAcademic Institutions and Nonprofits only -
pBbdCas9S(RBSmut)_Psyn-sgRNA500
Plasmid#149576Purposeparental, all-in-one CRISPRi vector for B. burgdorferi, parental for gRNA cloningDepositorTypeEmpty backboneUseCRISPRExpressionBacterialPromoterPflaB, PpQE30, PsynAvailable SinceNov. 25, 2020AvailabilityAcademic Institutions and Nonprofits only -
SPDK3889(TRV-RNA2-pPEBV-MCS-AtMet-tRNA)
Plasmid#149277PurposeModified Tobacco rattle virus RNA2 vector that could be used for expression of sgRNAsDepositorInsertModified TRV RNA2 with PEBV promoter and AtMet-tRNA mobile RNA sequence
UseT-dna vectorMutationT2318C (DNA) in PEBV coat protein sequenceAvailable SinceJune 23, 2020AvailabilityAcademic Institutions and Nonprofits only -
sgLenti-orthogonal
Plasmid#105997PurposeDual Streptococcus pyogenes and Staphylococcus aureus sgRNA expression vectorDepositorTypeEmpty backboneUseCRISPR and Lentiviral; S.pyogenes sgrna expressio…ExpressionMammalianPromoterU6Available SinceJan. 31, 2019AvailabilityAcademic Institutions and Nonprofits only -
pSW610 - GR-LhG4_BD
Plasmid#115992Purposeentry vector for GreenGate cloning method, CDS, with adaptors for B and D modulesDepositorInsertGR-LhG4_BD
UseUnspecifiedAvailable SinceDec. 11, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCR-II-TOPO-mitfa_LexPR-2A-Cerulean-SV40pA-FRT-Kan-FRT: Sequences,
Plasmid#110201PurposeMelanocyte-specific expression of the LexPR-2A-Cerulean fusionDepositorInsertLexPR transactivator - 2A - Cerulean
TagsCeruleanExpressionBacterialAvailable SinceOct. 29, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCAGG-NFIX2
Plasmid#112699PurposeExpression of NFIX2 protein and GFPDepositorAvailable SinceJuly 6, 2018AvailabilityAcademic Institutions and Nonprofits only -
pJM230 (pUC18T-miniTn7T-gm-rhaSR-PrhaBAD-stRBS-lacZ)
Plasmid#110560PurposeminiTn7 delivery plasmid with rhaSR-PrhaBAD inducible promoter and StRBS-lacZ insertDepositorInsertstRBS-lacZ
ExpressionBacterialPromoterrhaSR-PrhaBADAvailable SinceMay 23, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pExodus
Plasmid#39991DepositorTypeEmpty backboneExpressionBacterial and MammalianPromoterCMV, T7Available SinceSept. 27, 2012AvailabilityAcademic Institutions and Nonprofits only -
Lenti-sgCrebbp#2/Cre
Plasmid#193210PurposeLentiviral vector expressing Cre recombinase (driven by mPGK promoter) and an sgRNA against the mouse Crebbp geneDepositorAvailable SinceDec. 12, 2022AvailabilityAcademic Institutions and Nonprofits only -
p426_Cas9_gRNA-HIS3b
Plasmid#87402PurposeAll-in-one CRISPR plasmid for integrating, deleting, or replacing a gene in S. cerevisiae. High-copy, URA3 plasmid contains human codon-optimized Cas9 and a guide RNA targeting HIS3b sequence AATATAGAGTGTACTAGAGG in yeast chromosome 15.DepositorInsertHuman Optimized S. pyogenes Cas9 and guide RNA targeting HIS3b
UseCRISPRPromoterADH1, pTyrosineAvailable SinceApril 5, 2017AvailabilityAcademic Institutions and Nonprofits only -
p426_Cas9_gRNA-ARS208a
Plasmid#87383PurposeAll-in-one CRISPR plasmid for integrating, deleting, or replacing a gene in S. cerevisiae. High-copy, URA3 plasmid contains human codon-optimized Cas9 and a guide RNA targeting ARS208a sequence GTCCGCTAAACAAAAGATCT in yeast chromosome 2.DepositorInsertHuman Optimized S. pyogenes Cas9 and guide RNA targeting ARS208a
UseCRISPRPromoterADH1, pTyrosineAvailable SinceApril 5, 2017AvailabilityAcademic Institutions and Nonprofits only