We narrowed to 13,452 results for: Mpl;
-
Plasmid#26402DepositorAvailable SinceNov. 23, 2010AvailabilityAcademic Institutions and Nonprofits only
-
pETM11-6xHis-TEV-hORF1p
Plasmid#202589PurposeAllows for IPTG-inducible expression of the human L1RP ORF1 protein in bacteria with an N-terminal 6xHis tag and TEV cleavage site for purification with a minimal scarDepositorInsertORF1p
Tags6x His and TEV protease cleavage siteExpressionBacterialAvailable SinceJune 4, 2025AvailabilityAcademic Institutions and Nonprofits only -
pBS-KDRT-STOP-loxP-3XP3::dsRed-loxP-STOP-KDRT-smGdP-10XV5
Plasmid#217510PurposeKD Recombinase dependent conditional smGdP-10XV5 cassetteDepositorInsertKDRT-STOP-loxP-3XP3::dsRed-loxP-STOP-KDRT-smGdP-10XV5
TagssmGdP-10XV5ExpressionInsectAvailable SinceMay 20, 2024AvailabilityAcademic Institutions and Nonprofits only -
pDESTmycIGF2BP3
Plasmid#19879DepositorInsertInsulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3 Human)
TagsMYCExpressionMammalianAvailable SinceDec. 31, 2008AvailabilityAcademic Institutions and Nonprofits only -
pSPIH6
Plasmid#190676PurposeE. coli plasmid for single step cloning of SUMO-peptide-intein (SPI) fusion proteins (contains SUMO and His-tagged intein)DepositorInsertsSmall ubiquitin-like modifier
Mxe GyrA intein with C-terminal chitin binding domain and His tag
TagsChitin binding domain, His tag, and N-terminal Hi…ExpressionBacterialMutationAdded C-terminal his tag and NonePromoterT7Available SinceFeb. 21, 2023AvailabilityAcademic Institutions and Nonprofits only -
-
pGL3-E-cadherin promoter
Plasmid#61798PurposeLuciferase reporter containing the mouse E-cadherin promoterDepositorInsert-178/+92 fragment of the mouse Cdh1 promoter (Cdh1 Mouse)
UseLuciferaseExpressionMammalianAvailable SinceMay 14, 2015AvailabilityAcademic Institutions and Nonprofits only -
pBabe puro-eIF4E
Plasmid#33252DepositorInserteIF4E (EIF4E Human)
UseRetroviralTagsuntaggedExpressionMammalianMutationunmodifiedPromoterSV40Available SinceJan. 3, 2012AvailabilityAcademic Institutions and Nonprofits only -
pAAV-SynI-CreOn-FlpOff-mNaChBac-P2A-EGFP
Plasmid#176280PurposeViral vector for co-expression of NaChBac and EGFP in cells expressing Cre AND NOT Flp driven by the human Synapsin promoter.DepositorInsertmNaChBac-P2A-EGFP
UseAAV and Cre/LoxExpressionMammalianPromoterhuman Synapsin IAvailable SinceJan. 11, 2022AvailabilityAcademic Institutions and Nonprofits only -
pGGD_MiniTurboID-YFP
Plasmid#222434PurposeGolden Gate / Green Gate module for adding MiniTurboID and YFP as C-terminus of target protein.DepositorInsertMiniTurboID (BirA mutant)
UseGolden gate / green gate compatible cloning vectorTagsLinker and YFPMutationaa1-63 deleted; Q65P, I87V, R118S, E140K, Q141R, …Available SinceJuly 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
C terminal Flag Mios pRK5
Plasmid#46326DepositorAvailable SinceJuly 15, 2013AvailabilityAcademic Institutions and Nonprofits only -
pEVOL-ABK
Plasmid#126035PurposeEfficient expression of tRNA synthetase/tRNA for the incorporation of a photo-cross-linker, 3’-azibutyl-N-carbamoyl-lysine (AbK) into recombinant protein by amber codon (TAG) suppression in E. coli.DepositorInsertstRNA synthetase 1
tRNA synthetase 2
tRNA for TAG codon
ExpressionBacterialMutationL274M, C313A, Y349FPromoteraraBAD promoter, glnS promoter, and proK promoterAvailable SinceSept. 10, 2019AvailabilityAcademic Institutions and Nonprofits only -
-
pBacPAK8-2xHA-MOF
Plasmid#29763DepositorAvailable SinceNov. 15, 2013AvailabilityAcademic Institutions and Nonprofits only -
Flag-V0A
Plasmid#210347PurposeExpresses ATP6V0A in mammalian cellsDepositorAvailable SinceJan. 2, 2024AvailabilityAcademic Institutions and Nonprofits only -
pDEST-DHFR F[3]-C (LEU2)
Plasmid#177796PurposeGateway destination vector to insert genes of interest having a C-terminal DHFR F[3] fusion for DHFR-PCA/BFG-PCA assays.DepositorTypeEmpty backboneTagsDHFR F[3]ExpressionYeastPromoterADH1Available SinceJan. 11, 2022AvailabilityAcademic Institutions and Nonprofits only -
R4pGWB601_UBQ10p-Turbo-NES-YFP
Plasmid#127366PurposeBinary vector for expressing cytosolic TurboID-YFP under the UBQ10 promoter in plantsDepositorInsertTurboID (BirA mutant)
TagsGS linker, NES, V5, and YFPExpressionPlantMutationQ65P, I87V, R118S, E140K, Q141R, S150G, L151P, V1…PromoterArabidopsis UBQ10 promoterAvailable SinceSept. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
R4pGWB601_UBQ10p-Turbo-YFP-NLS
Plasmid#127368PurposeBinary vector for expressing nuclear TurboID-YFP under the UBQ10 promoter in plantsDepositorInsertTurboID (BirA mutant)
TagsGS linker, NLS, V5, and YFPExpressionPlantMutationQ65P, I87V, R118S, E140K, Q141R, S150G, L151P, V1…PromoterArabidopsis UBQ10 promoterAvailable SinceSept. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCSN068
Plasmid#101749PurposeSingle copy yeast plasmid expressing Cpf1 from Francisella novicida U112 (FnCpf1), codon optimized for expression in Saccharomyces cerevisiae.DepositorInsertsCpf1 from Francisella novicida U112 (FnCpf1) codon optimized for expression in S. cerevisiae.
KanMX marker expression cassette.
UseCRISPRTagsSV40 NLSExpressionYeastPromoterHeterologous TEF1 promoter from A. gossypii. and …Available SinceJan. 23, 2018AvailabilityAcademic Institutions and Nonprofits only -
STAT3(Y705F)-TAL-Luc
Plasmid#46933PurposeLuciferase Reporter for mutant STAT3DepositorInsertSTAT3(Y705F) (STAT3 Human)
UseLuciferaseTagsFLAGMutationTyrosine 705 to PhenylalaninePromoterTA LuciferaseAvailable SinceNov. 7, 2013AvailabilityAcademic Institutions and Nonprofits only -
pYTRW09K_0T5
Plasmid#177281Purposegenomic integration of genes (inserted in I-SceI-site) via transposon Tn5 with TcRDepositorInsertPtet-tetA(C)
UseSynthetic Biology; Yeast expression, tn5 genomic …ExpressionBacterialAvailable SinceAug. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pGL3 Zscan4 promoter
Plasmid#69249PurposeLuciferase reporter for Dux4 activation of Zscan4 transcriptionDepositorInsertZscan4 (ZSCAN4 Human)
UseLuciferaseMutationThe two single nucleotide mismatches found betwee…PromoterZscan4Available SinceSept. 21, 2015AvailabilityAcademic Institutions and Nonprofits only -
qTAG-C-mScarlet-Puro-H2BC11
Plasmid#207761PurposeDonor template for mScarlet-2A-Puro insertion into the C-terminus of the H2BC11 locus for nuclei visualization. To be co-transfected with sgRNA plasmid px330-PITCh-H2BC11 Addgene #207755DepositorInsertH2BC11 Homology Arms flanking a mScarlet-Puro Cassette (H2BC11 Human)
UseCRISPR; Donor templateExpressionMammalianAvailable SinceNov. 17, 2023AvailabilityIndustry, Academic Institutions, and Nonprofits -
pSLQ2817 pPB: CAG-PYL1-VPR-IRES-Puro-WPRE-SV40PA PGK-ABI-tagBFP-SpdCas9
Plasmid#84239PurposeExpresses ABA-inducible VPR-Sp dCas9DepositorInsertsABI-tagBFP-Sp dCas9
PYL1-VPR
UseCRISPR and Synthetic Biology; PiggybacTags2xNLS (SV40), ABI, HA tag, IRES-Puro, PYL1, and t…ExpressionMammalianPromoterCAG and PGKAvailable SinceNov. 9, 2016AvailabilityAcademic Institutions and Nonprofits only -
pGEX-6P-1 p37deltaSEP
Plasmid#113501PurposeBacterial expression of GST-tagged p37 lacking the SEP domainDepositorInsertp37 (Ubxn2b Mouse)
TagsGST-PreScission protease siteExpressionBacterialMutationdelta 140-206Available SinceOct. 11, 2018AvailabilityAcademic Institutions and Nonprofits only -
ALFA-bArr1
Plasmid#201495PurposeExpression of the beta-arrestin1 containing a N-terminal ALFA tag.DepositorAvailable SinceAug. 10, 2023AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CKIIa-stGtACR2-FusionRed
Plasmid#105669PurposeExpresses a soma-targeted GtACR2 in mammalian neurons under the CaMKIIa promoterDepositorHas ServiceAAV Retrograde and AAV1InsertstGtACR2
UseAAVTagsFusionRed and Kv2.1ExpressionMammalianPromoterCaMKIIaAvailable SinceFeb. 23, 2018AvailabilityAcademic Institutions and Nonprofits only -
OPEN HLA-A*02:01-BirA
Plasmid#215569PurposeE. coli expression of BirA tagged HLA-A*02:01 containing a cysteine mutation for disulfide linkage to mutant beta-2 microglobulin.DepositorInsertOPEN HLA-A*02:01 (HLA-A Human)
TagsBirAExpressionBacterialMutationGlycine 120 to CysteinePromoterT7Available SinceMarch 27, 2024AvailabilityAcademic Institutions and Nonprofits only -
pBpaRS3tRNA
Plasmid#197102PurposeTo express the p-benzoylphenylalanine-specific variant of Methanocaldococcus jannaschii TyrRS and its cognate amber suppressor tRNA and allow UAG codon to be translated into p-benzoylphenylalanine.DepositorInsertTyrRS variant, amber suppressor tRNA
ExpressionBacterialMutationGly32, Ser107, Thr158, Ser159, Arg286 (TyrRS)Available SinceJune 15, 2023AvailabilityAcademic Institutions and Nonprofits only -
pLV-U6-UL29-egfp-U3-UL8
Plasmid#166694PurposeTo express gRNA expression cassette simultaneously targeting two genes: UL8 and UL29 (EGFP version).DepositorAvailable SinceDec. 9, 2021AvailabilityAcademic Institutions and Nonprofits only -
pMT1-24X-NOG(AtUBI10)
Plasmid#202016PurposeT-DNA vector for expression of the two protein components of the MoonTag system (dCas9-24XGP41 and NbGP41P-sfGFP-VP64-GB1) under the control of the AtUBI10 promoter.DepositorInsertsdCas9-24XGP41
NbGP41P-sfGFP-VP64-GB1
TagsGB1 and sfGFPExpressionPlantPromoterAtUBI10Available SinceAug. 21, 2023AvailabilityAcademic Institutions and Nonprofits only -
TK-GFP-Nluc-P2A-neo-TK
Plasmid#134896PurposeExpresses GFP protein and a fusion protein of Nluc-neo inserting into Cryptosporidium parvum TK locusDepositorInsertTK-GFP-Nluc-P2A-Neo-TK
UseCryptosporidium expressionPromoterCryptosporidium actin and enolaseAvailable SinceNov. 27, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5-FRT-TO-Nsp16-HF
Plasmid#157725Purposemammalian expression of C-terminally His8-Flag tagged SARS-CoV-2 Nsp16 under control of a tetracycline-inducible promoterDepositorAvailable SinceAug. 6, 2020AvailabilityIndustry, Academic Institutions, and Nonprofits -
FKBP10-EGFP
Plasmid#210369PurposeExpresses FKBP10 fused with EGFP in mammalian cellsDepositorAvailable SinceDec. 18, 2023AvailabilityAcademic Institutions and Nonprofits only -
pHAGE-mCherry-CLCN3
Plasmid#225514PurposeLentiviral mCherry-CLCN3 expression vectorDepositorAvailable SinceMay 14, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5-FRT-TO-Nsp16
Plasmid#157723Purposemammalian expression of untagged SARS-CoV-2 Nsp16 under control of a tetracycline-inducible promoterDepositorAvailable SinceAug. 6, 2020AvailabilityIndustry, Academic Institutions, and Nonprofits -
pTP261
Plasmid#104166PurposeBacterial expression plasmid of anti-GFP nanobody with 1x Cysteine for maleimide labelingDepositorInsertAnti-GFP nanobody Enhancer PDB 3K1K (1x Cysteine)
Tags14x Histidine tag and NEDD8 from Brachypodium dis…ExpressionBacterialMutation1x Cysteine located at bps 493-495 in full sequen…Available SinceOct. 11, 2018AvailabilityAcademic Institutions and Nonprofits only -
OPEN-HLA-B*07:02-BirA
Plasmid#239752PurposeE. coli expression of BirA tagged HLA-B*07:02 containing a cysteine mutation for disulfide linkage to mutant beta-2 microglobulinDepositorInsertOPEN-HLA-B*07:02 (HLA-B Human)
TagsBirA substrate peptideExpressionBacterialMutationG120CPromoterT7Available SinceAug. 18, 2025AvailabilityAcademic Institutions and Nonprofits only -
OPEN-HLA-A*11:01-BirA
Plasmid#235135PurposeE. coli expression of BirA tagged HLA-A*11:01 containing a cysteine mutation for disulfide linkage to mutant beta-2 microglobulin.DepositorAvailable SinceApril 8, 2025AvailabilityAcademic Institutions and Nonprofits only -
R4pGWB601_UBQ10p-miniTurbo-YFP-NLS
Plasmid#127370PurposeBinary vector for expressing nuclear miniTurbo-YFP under the UBQ10 promoter in plantsDepositorInsertminiTurbo (BirA mutant)
TagsGS linker, NLS, V5, and YFPExpressionPlantMutationaa1-63 deleted; Q65P, I87V, R118S, E140K, Q141R, …PromoterArabidopsis UBQ10 promoterAvailable SinceSept. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pGGB_YFP-MiniTurboID
Plasmid#222433PurposeGolden Gate / Green Gate module for adding YFP and MiniTurboID as N-terminus of target protein.DepositorInsertMiniTurboID (BirA mutant)
UseGolden gate / green gate compatible cloning vectorTagsLinker and YFPMutationaa1-63 deleted; Q65P, I87V, R118S, E140K, Q141R, …Available SinceJuly 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
pEGFP Abi1
Plasmid#74905PurposeExpresses human Abi1 fused to GFPDepositorAvailable SinceMay 3, 2016AvailabilityAcademic Institutions and Nonprofits only -
Lamp1-mCherry-RUSH
Plasmid#202799PurposeRUSH cargo: Str-KDEL_IRES_SBP-mCherry-Lamp1DepositorAvailable SinceAug. 18, 2023AvailabilityAcademic Institutions and Nonprofits only -
pFastBac_His-ZZ-TEV-Lis1-SNAPf
Plasmid#133073PurposePlasmid for insect cell expression of human full-length LIS1 with an N terminal His-ZZ-LTLT tag and C terminal SNAPf tagDepositorAvailable SinceOct. 30, 2019AvailabilityAcademic Institutions and Nonprofits only -
pLenti-5HRE-GFP PuroR
Plasmid#128958PurposeLentiviral plasmid for expression of hypoxia-responsive enhanced green fluorescent proteinDepositorInsert5X HRE of VEGF (VEGFA Human)
UseLentiviralTagsd2EGFPExpressionMammalianPromoterminimal CMV promoterAvailable SinceJune 22, 2022AvailabilityAcademic Institutions and Nonprofits only -
pSF3-Flag-CBir-FRB_Myc-NBir-FKBP
Plasmid#90003PurposeSplit-BioID plasmid: Expresses N-terminally tagged CBir[257-321]-FRB and N-terminally tagged NBir[2-256]-FKBPDepositorInsertsNBirA*-linker-FKBP
CBirA*-linker-FRB
UseRetroviral; Flp/frtTagsFLAG and MycExpressionMammalianPromoterCMVAvailable SinceJuly 5, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCDNA3-HA-HA-human CMYC S62A
Plasmid#203436PurposeMammalian expression of MYCDepositorAvailable SinceAug. 11, 2023AvailabilityAcademic Institutions and Nonprofits only -
pRDA_174_neoR
Plasmid#228935PurposeLentiviral expression of EnAsCas12aDepositorTypeEmpty backboneUseCRISPR and LentiviralExpressionMammalianAvailable SinceApril 3, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
qTAG-C-moxGFP-Blast-H2BC11
Plasmid#207757PurposeDonor template for moxGFP-2A-Blast insertion into the C-terminus of the H2BC11 locus for nuclei visualization. To be co-transfected with sgRNA plasmid px330-PITCh-H2BC11 Addgene #207755DepositorInsertH2BC11 Homology Arms flanking a moxGFP-Blast Cassette (H2BC11 Human)
UseCRISPR; Donor templateExpressionMammalianAvailable SinceNov. 16, 2023AvailabilityIndustry, Academic Institutions, and Nonprofits