We narrowed to 24,987 results for: Nov;
-
Plasmid#146551PurposeMammalian Expression of HsSmg6DepositorInsertHsSmg6 (SMG6 Human)
ExpressionMammalianMutationtwo silent mutations T594C, A699G and two non sil…Available SinceMarch 16, 2023AvailabilityAcademic Institutions and Nonprofits only -
pRK5-HA-FNIP2
Plasmid#72295PurposeoverexpressionDepositorAvailable SinceFeb. 2, 2016AvailabilityAcademic Institutions and Nonprofits only -
pMSCV-Flag-hOct4
Plasmid#20072DepositorAvailable SinceJan. 9, 2009AvailabilityAcademic Institutions and Nonprofits only -
pHR-CMV-TetO2_HA-BirA
Plasmid#113896PurposeMammalian (inducible) expression of HA-tagged cytosolic E. coli biotin ligaseDepositorInsertE. coli biotin ligase
UseLentiviralTagsHAPromoterCMV-MIE-TetO2Available SinceAug. 28, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5-FRT-TO-Nsp16
Plasmid#157723Purposemammalian expression of untagged SARS-CoV-2 Nsp16 under control of a tetracycline-inducible promoterDepositorAvailable SinceAug. 6, 2020AvailabilityIndustry, Academic Institutions, and Nonprofits -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
CLXSN 5myc-CDC6-WT
Plasmid#109332Purposeexpress tagged Cdc6 WTDepositorAvailable SinceJuly 25, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-Akt-STOPS
Plasmid#175006PurposeAkt Substrate-based Tandem Occupancy Peptide Sponge. Genetically encoded for perturbing cellular Akt kinase activity.DepositorInsertmCherry-Akt-STOPS
Tags6xHIS - T7 tag (gene 10 leader) - Xpress (TM) tag…ExpressionMammalianPromoterCMVAvailable SinceJan. 7, 2022AvailabilityAcademic Institutions and Nonprofits only -
AP-1 mu1-GFP
Plasmid#173432PurposeExpression of AP-1 Mu1 subunit with a terminal GFPDepositorAvailable SinceAug. 17, 2021AvailabilityAcademic Institutions and Nonprofits only -
EF1a_GATA6_P2A_Hygro_Barcode
Plasmid#120445PurposeBarcoded lentiviral vector to express GATA6 in mammalian cells under control of EF1a promoter. Barcoded for transcript detection in single cell RNA-seq.DepositorAvailable SinceFeb. 4, 2019AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CAG-RdLight1
Plasmid#125707PurposeExpresses the red genetically encoded dopamine sensor RdLight1 in mammalian cells.DepositorHas ServiceAAV9InsertdLight1.3b
UseAAVTagsFlag tagExpressionMammalianPromoterCAGAvailable SinceAug. 12, 2021AvailabilityAcademic Institutions and Nonprofits only -
pCAG/ATP8B4-HA
Plasmid#209212PurposeMammalian expression of ATP8B4DepositorAvailable SinceNov. 7, 2023AvailabilityAcademic Institutions and Nonprofits only -
PH-PLCD1_mScarlet-H_IRES_SYFP2_PH_N1
Plasmid#85070PurposeYellow/red FRET biosensor for monotoring plasmamembrane PtdIns(4,5)P2 levels (PIP2)DepositorInsertPH-PLCD1 (PLCD1 Human)
TagsIRES-sYFP2-PH and mScarlet-HExpressionMammalianMutationPLCD aa 1–170PromoterCMVAvailable SinceMarch 16, 2017AvailabilityAcademic Institutions and Nonprofits only -
kiCAP-AAV-MDV1A
Plasmid#196679PurposeRep/Cap plasmid for the production of MDV1A, an AAV capsid with CNS tropism in mice.DepositorInsertAAV9 VP1 modified with 7mer insertion between amino acids 588 and 589
UseAAVMutationRSVGSVY insert between amino acids 588 and 589 of…Promoterp41Available SinceMarch 9, 2023AvailabilityAcademic Institutions and Nonprofits only -
pHR-CMV-TetO2_3C-Twin-Strep_IRES-mTurquoise2
Plasmid#113886PurposeMammalian (inducible) protein expression, bicistronic expression of cytosolic mTurquoise2DepositorTypeEmpty backboneUseLentiviralTags3C-Twin-StrepPromoterCMV-MIE-TetO2Available SinceAug. 24, 2018AvailabilityAcademic Institutions and Nonprofits only -
pLV_TRET_hNgn1_UBC_Bla
Plasmid#61473Purpose3rd generation lentiviral vector; TetON promoter driving human Ngn1; constitutive expression of Blasticidine selection markerDepositorInsertsUseLentiviralAvailable SinceFeb. 12, 2015AvailabilityAcademic Institutions and Nonprofits only -
Plxna1-AP-His
Plasmid#71996PurposeExpresses the extracellular region of the PlexinA1 protein, C-terminally fused to alkaline phosphatase + 6X histidine tag.DepositorAvailable SinceFeb. 24, 2016AvailabilityAcademic Institutions and Nonprofits only -
pKS071 - pCAGGS-3XFLAG-mKate2-(human)PDS5A-bpA
Plasmid#156449PurposeFor transient expression of human PDS5A tagged with mKate2DepositorAvailable SinceSept. 2, 2020AvailabilityAcademic Institutions and Nonprofits only -
pMK312 (TOP2A CRISPR)
Plasmid#140654PurposeTOP2A tagging CRISPRDepositorAvailable SinceNov. 12, 2020AvailabilityAcademic Institutions and Nonprofits only -
pcDNAI-GAL4-CREB
Plasmid#46769PurposeExpression of GAL4 fusion to wild type CREBDepositorTagsGAL4ExpressionMammalianPromoterCMVAvailable SinceJuly 30, 2013AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1 human cofilin S3E
Plasmid#50855Purposeexpresses psuedo-phosporylated, non-activatable cofilin in mammalian cellsDepositorInsertcofilin 1 S3E (CFL1 Human)
ExpressionMammalianMutationS3E psuedo-phosporylated, non-activatablePromoterCMVAvailable SinceFeb. 5, 2014AvailabilityIndustry, Academic Institutions, and Nonprofits -
TRE-STOP EF1a-rtTA3
Plasmid#195882Purposecontrol construct of TRE-VEGFA EF1a-rtTA3DepositorAvailable SinceSept. 12, 2023AvailabilityAcademic Institutions and Nonprofits only -
pHR-CMV-TetO2_3C-Avi-His6_IRES-mRuby2
Plasmid#113889PurposeMammalian (inducible) protein expression, in vivo biotinylation, bicistronic expression of cytosolic mRuby2DepositorTypeEmpty backboneUseLentiviralTags3C-Avi-His6PromoterCMV-MIE-TetO2Available SinceAug. 27, 2018AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-mRuby3-Zeo
Plasmid#167206PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with mRuby3 and selection with ZeocinDepositorTypeEmpty backboneUseCRISPRTagsmRuby3ExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pME-nls-sfGFP
Plasmid#132973Purposefull-length of nuclear localized sfGFP with stop codon in pmE Gateway vectorDepositorInsertnuclear localized super folder GFP
UseGateway vectorTags6x myc and SV40 NLSAvailable SinceDec. 4, 2019AvailabilityAcademic Institutions and Nonprofits only -
pMRX-IBU-pSu9-HaloTag7-SNAP
Plasmid#217319PurposeExpresses the presequence of Neurospora crassa Fo-ATPase subunit 9 (residues 1–69) with HaloTag and SNAP tag for measuring mitophagy activity by Halo processing assay.DepositorInsertNeurospora crassa Fo-ATPase subunit 9 (residues 1–69) with HaloTag and SNAP tag
UseRetroviralTagsHaloTag and SNAPPromoterCMVAvailable SinceNov. 22, 2024AvailabilityAcademic Institutions and Nonprofits only -
pWAP-HGF
Plasmid#83503PurposeGeneration of transgenic mice overexpressing the HGF under the control of the WAP gene promoterDepositorInsertHGF (Hgf Mouse)
UseMouse TargetingMutationalso contains beta-globin sequences from pUC198Promotermouse WAP (whey acidic protein)Available SinceFeb. 7, 2017AvailabilityAcademic Institutions and Nonprofits only -
SMC2 CRISPR
Plasmid#140649PurposeSMC2 tagging CRISPRDepositorAvailable SinceNov. 12, 2020AvailabilityAcademic Institutions and Nonprofits only -
pCAG/ATP8B2-HA
Plasmid#209210PurposeMammalian expression of ATP8B2DepositorAvailable SinceOct. 27, 2023AvailabilityAcademic Institutions and Nonprofits only -
pQCXIH-tag RFPt- Rab11a WT
Plasmid#161992PurposeRetroviral expression vector containing Rab11a tagged with RFPDepositorAvailable SinceDec. 7, 2020AvailabilityAcademic Institutions and Nonprofits only