We narrowed to 18,653 results for: MUT
-
Plasmid#16510DepositorAvailable SinceApril 30, 2008AvailabilityAcademic Institutions and Nonprofits only
-
R4pGWB601_UBQ10p-miniTurbo-YFP-NLS
Plasmid#127370PurposeBinary vector for expressing nuclear miniTurbo-YFP under the UBQ10 promoter in plantsDepositorInsertminiTurbo (BirA mutant)
TagsGS linker, NLS, V5, and YFPExpressionPlantMutationaa1-63 deleted; Q65P, I87V, R118S, E140K, Q141R, …PromoterArabidopsis UBQ10 promoterAvailable SinceSept. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pENN.AAV.TBG.PI.N-FLAG-mSTAT5bCA.WPRE.bGH
Plasmid#184463PurposepENN.AAV.TBG.PI.N-FLAG-mSTAT5bCA.WPRE.bGH express N-flag tag STAT5bCA carrying a point mutation at base 1963 (A to C), which changes Asn642 to His, conferring constitutive activity (CA) to STAT5b.DepositorInsertN-Flag-mSTAT5bCA (Stat5b Mouse)
UseAAVTagsFLAG TagExpressionMammalianMutationPoint mutation at base 1963 (A to C), which chang…Available SinceMay 16, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV-Neo-Bam APC 1-2644
Plasmid#16511DepositorAvailable SinceApril 30, 2008AvailabilityAcademic Institutions and Nonprofits only -
pICE-HA-MRE11-H129N
Plasmid#82034PurposePlasmid for constitutive or doxycycline-inducible expression of H129N nuclease-dead mutant of human MRE11. Confers resistance to puromycin. Use T-REx cells for doxycycline-inducible expression.DepositorInsertMRE11 (MRE11 Human)
TagsHAExpressionMammalianMutationNuclease-dead mutant: H129N MRE11PromoterCMV-tetAvailable SinceSept. 20, 2016AvailabilityAcademic Institutions and Nonprofits only -
DPYSL2-pLJC2
Plasmid#189866PurposeExpresses human DPYSL2 (CRMP2) in mammalian cellsDepositorAvailable SinceSept. 27, 2022AvailabilityAcademic Institutions and Nonprofits only -
pPing
Plasmid#47100PurposeExpresses the Ping open reading frame 1 (ORF1) and transposase from rice to allow mPing movement. The vector contains ORF1, transposase, mPing element and hph for hygromycin selection.DepositorInsertsPing cDNA
mPing
hygromycin resistance gene
UsePlant expressionTagsGFPExpressionYeastPromoterCaMV35s and StUbi3Available SinceSept. 16, 2013AvailabilityIndustry, Academic Institutions, and Nonprofits -
GFP-CA-mDia1
Plasmid#45583DepositorInsertConstitutively active mDia1 (CA-mDia1) (Diaph1 Mouse)
TagsGFPExpressionMammalianMutationInsert mDia1 contains mutations V161D and N165D i…PromoterCMVAvailable SinceApril 15, 2014AvailabilityAcademic Institutions and Nonprofits only -
pAG26
Plasmid#226743PurposeExpresses a reporter for a mitochondrial intermembrane space proteinDepositorAvailable SinceOct. 24, 2024AvailabilityAcademic Institutions and Nonprofits only -
pLenti6-DEST PINK1-V5 KD
Plasmid#13319DepositorInsertPINK1 (PINK1 Human)
UseLentiviralTagsV5ExpressionMammalianMutationKinase dead: K219A/D362A/D384AAvailable SinceOct. 16, 2006AvailabilityAcademic Institutions and Nonprofits only -
pAAV-syn-Flpo
Plasmid#174378Purposealso known as: pAAV-synP-FLPo. AAV virus for expressing FLPo recombinaseDepositorHas ServiceAAV RetrogradeInsertFLPo recombinase
UseAAVAvailable SinceSept. 22, 2021AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1(+)-ExRai-AKAR2(T/A)
Plasmid#161754PurposeNegative-control mutant for ExRai-AKAR2 biosensor.DepositorInsertExRai-AKAR2(T/A)
ExpressionMammalianMutationContains Thr-to-Ala mutation in substrate sequenc…PromoterCMVAvailable SinceNov. 18, 2020AvailabilityAcademic Institutions and Nonprofits only -
pDONR_P2R-P3_R2-Turbo-mVenus-STOP-L3
Plasmid#127354Purposegateway entry vector for making C-terminal TurboID-mVenus fusion with nuclear and non-nuclear proteinsDepositorInsertTurboID (BirA mutant)
UseGateway entry vectorTagsGS linker, V5, and mVenusMutationQ65P, I87V, R118S, E140K, Q141R, S150G, L151P, V1…Promoterno promoterAvailable SinceSept. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pICE-HA-MRE11-H63D
Plasmid#82036PurposePlasmid for constitutive or doxycycline-inducible expression of H63D exonuclease-dead mutant of human MRE11. Confers resistance to puromycin. Use T-REx cells for doxycycline-inducible expression.DepositorInsertMRE11 (MRE11 Human)
TagsHAExpressionMammalianMutationExonuclease-dead mutant: H63D MRE11PromoterCMV-tetAvailable SinceSept. 20, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCMV-Neo-Bam APC 1-331
Plasmid#16508DepositorAvailable SinceApril 30, 2008AvailabilityAcademic Institutions and Nonprofits only -
pGGB_YFP-MiniTurboID
Plasmid#222433PurposeGolden Gate / Green Gate module for adding YFP and MiniTurboID as N-terminus of target protein.DepositorInsertMiniTurboID (BirA mutant)
UseGolden gate / green gate compatible cloning vectorTagsLinker and YFPMutationaa1-63 deleted; Q65P, I87V, R118S, E140K, Q141R, …Available SinceJuly 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
pU6-SasgRNA scaffold-CMV-nSaCas9
Plasmid#171695PurposeExpresses nSaCas9 in mammalian cellsDepositorInsertsgRNA scaffold-nSaCas9-NLS
UseCRISPRExpressionMammalianMutationD10APromoterU6 and CMVAvailable SinceAug. 9, 2021AvailabilityAcademic Institutions and Nonprofits only -
pmCherry-Sec24D
Plasmid#32677DepositorAvailable SinceJune 13, 2012AvailabilityAcademic Institutions and Nonprofits only -
pLV-Kif5b-T92N-Myc
Plasmid#186615PurposeThird generation lentiviral vector expressing Kinesin Heavy Chain 5 isoform B Rigor mutant (T92N) fused to Myc tagDepositorInsertKinesin Heavy Chain isoform 5b Rigor mutant (T92N) (KIF5B Human)
UseLentiviralTagsMyc tagExpressionMammalianMutationT92NPromoterCMVAvailable SinceFeb. 1, 2023AvailabilityAcademic Institutions and Nonprofits only -
peGFP C3-SPG20-PAAA
Plasmid#218581PurposeExpresses GFP-tagged PPAY motif mutant (PAAA) of human SPG20 in mammalian cells; this mutant does not interact with ITCHDepositorInsertSPG20 (SPART Human)
TagseGFPExpressionMammalianMutationchanged Proline 172 to Alanine and Tyrosine 174 t…PromoterCMVAvailable SinceMay 6, 2024AvailabilityAcademic Institutions and Nonprofits only -
pTSara
Plasmid#60720PurposeExpresses both fragments of T7 RNAP split at position 179. Both fragments are driven by the arabinose inducible promoter PBAD. Also contains a constitutive araC ORFDepositorInsertsN Terminal fragment of T7 RNAP split betwen 179-180
N Terminal fragment of T7 RNAP split betwen 179-180
ExpressionBacterialMutationT7 RNAP split between positions 179-180 and wt T7…PromoterPBADAvailable SinceDec. 18, 2014AvailabilityAcademic Institutions and Nonprofits only -
pRR.1
Plasmid#69995PurposeMammalian expression of cytochrome p450 CYP2B6DepositorAvailable SinceNov. 11, 2015AvailabilityAcademic Institutions and Nonprofits only -
pRK5-HA-GST-4EBP1-Low GC
Plasmid#69018Purposeexpresses tagged 4EBP1DepositorInsertEIF4EBP1 (EIF4EBP1 Human)
TagsGST and HAExpressionMammalianMutationlowGC content, wt is ~70% GC rich. Still, it code…Available SinceJan. 2, 2018AvailabilityAcademic Institutions and Nonprofits only -
pBp-FGFR2b-WT
Plasmid#45698DepositorAvailable SinceJune 17, 2013AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
V2R-GFP
Plasmid#208910Purposeencodes the human vasopressin receptor 2, tagged with GFPDepositorAvailable SinceNov. 1, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCW-HA-hRb-delta-CDK-puro
Plasmid#212673PurposeExpress tagged hRb delta-CDK phosphosite mutantDepositorInsertRb (RB1 Human)
UseLentiviralTagsHAMutationAll 15 CDK phospho-sites are mutated to alaninesPromoterTREAvailable SinceAug. 5, 2024AvailabilityAcademic Institutions and Nonprofits only -
pWZL Blast Twist ER
Plasmid#18799DepositorInserttwist (Twist1 Mouse)
UseRetroviralTagsER hormone binding domainExpressionMammalianMutationG525R mutation in the ER. The presence of the G52…Available SinceJuly 3, 2008AvailabilityAcademic Institutions and Nonprofits only -
R4pGWB601_UBQ10p-miniTurbo-NES-YFP
Plasmid#127369PurposeBinary vector for expressing cytosolic miniTurbo-YFP under the UBQ10 promoter in plantsDepositorInsertminiTurbo (BirA mutant)
TagsGS linker, NES, V5, and YFPExpressionPlantMutationaa1-63 deleted; Q65P, I87V, R118S, E140K, Q141R, …PromoterArabidopsis UBQ10 promoterAvailable SinceSept. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-ATF6-(S1P-)
Plasmid#32956PurposeFor visualization of ATF6 in mammalian cells with a mutation in ATF6 that blocks cleavage by protease S1P. Activated protein will remain in the Golgi.DepositorInsertATF6 (ATF6 Human)
TagsEGFPExpressionMammalianMutationS1Protease site mutation: R415A/R416APromoterCMVAvailable SinceFeb. 2, 2012AvailabilityAcademic Institutions and Nonprofits only