We narrowed to 13,645 results for: sequence
-
Plasmid#193303PurposeExpresses mTurq2-Apollo-NADP+ sensor localized to the mitochondriaDepositorInsertG6PD (G6PD Human)
TagsmTurqoise2 and mitochondrial targeting sequenceExpressionMammalianMutationS40A, R72Q, H201N, K205TPromoterT7Available SinceMay 3, 2023AvailabilityAcademic Institutions and Nonprofits only -
lenti sgRNA(MS2)_zeo backbone
Plasmid#61427Purpose3rd generation lenti sgRNA cloning backbone with MS2 loops at tetraloop and stemloop 2 and EF1a-zeo resistance marker. Contains BsmBI sites for insertion of spacer sequences.DepositorHas ServiceCloning Grade DNATypeEmpty backboneUseCRISPR and LentiviralExpressionMammalianPromoterU6 and EF1AAvailable SinceDec. 15, 2014AvailabilityAcademic Institutions and Nonprofits only -
pGL3Luc-5XNF-kappaB
Plasmid#185695PurposeReporter plasmid with a double-strand oligonucleotides that contain five repeats of NF-kappaB binding consensus sequence (5'-GGGGAATTTCC-3').DepositorAvailable SinceOct. 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
tetO.Nfia.Blast
Plasmid#117270PurposeExpresses Nfia and blasticidin resistance gene under control of tetO sequence.DepositorAvailable SinceNov. 1, 2018AvailabilityAcademic Institutions and Nonprofits only -
pXL010-Wnt dual (GFP-Fire) reporter
Plasmid#40588DepositorInsertWnt reporter sequences
UseLentiviralExpressionMammalianPromoterWnt promoterAvailable SinceMay 31, 2018AvailabilityAcademic Institutions and Nonprofits only -
CROPseq-Guide-Puro
Plasmid#86708PurposeMakes CRISPR gRNAs detectable by single-cell RNA-seq. The gRNA is expressed as part of the puromycin resistance mRNA transcribed by RNA Pol II and in its functional form from the hU6 promoter.DepositorInsertEF1a-Puro-WPRE-hU6-gRNA
UseCRISPR and LentiviralExpressionMammalianPromoterhU6Available SinceFeb. 9, 2017AvailabilityAcademic Institutions and Nonprofits only -
pPalmitoyl-mTurquoise2
Plasmid#36209PurposeIn vivo visualization of the membrane (can be used for colocalization studies)DepositorAvailable SinceAug. 15, 2012AvailabilityAcademic Institutions and Nonprofits only -
pHSE401
Plasmid#62201PurposeCRISPR/Cas based plant genome editing and gene regulation; expresses 3×FLAG-NLS-zCas9-NLS, gRNA scaffold for insertion of target sequence (AtU6-26 promoter), Hyg resistanceDepositorInsertsgRNA scaffold
zCas9
UsePlant binary vectorTags3x FLAG and NLSExpressionPlantMutationmaize codon optimizedPromoter35S and AtU6-26pAvailable SinceApril 29, 2015AvailabilityAcademic Institutions and Nonprofits only -
pAIDA_TEV_fap2EC
Plasmid#246866PurposeExpression of Fusobacterium nucleatum ATCC23726 Fap2 extracellular domain (42-3271) with histag and TEV site in fusion with E. coli autotransporter AIDADepositorInsertF. nucleatum ATCC23726 Fap2 (extracellular domain, res. 42–3271)
Tags8x histidine, AIDA autotransporter, AIDA signal s…ExpressionBacterialAvailable SinceNov. 18, 2025AvailabilityAcademic Institutions and Nonprofits only -
pKSE401
Plasmid#62202PurposeCRISPR/Cas based plant genome editing and gene regulation; expresses 3×FLAG-NLS-zCas9-NLS, gRNA scaffold for insertion of target sequence (AtU6-26 promoter), Kan resistanceDepositorInsertsgRNA scaffold
zCas9
UsePlant binary vectorTags3x FLAG and NLSExpressionPlantMutationmaize codon optimizedPromoter35S and AtU6-26pAvailable SinceApril 29, 2015AvailabilityAcademic Institutions and Nonprofits only -
lenti sgRNA(MS2)_puro backbone
Plasmid#73795Purpose3rd generation lenti sgRNA cloning backbone with MS2 loops at tetraloop and stemloop 2 and EF1a-puro resistance marker. Contains BsmBI sites for insertion of spacer sequences.DepositorHas ServiceCloning Grade DNATypeEmpty backboneUseCRISPR and LentiviralExpressionMammalianPromoterU6 and EF1AAvailable SinceMarch 15, 2016AvailabilityAcademic Institutions and Nonprofits only -
pGWB502-omega
Plasmid#74845PurposeGateway cloning compatible binary vector for expression of gene by 2xCaMV35S enhancer and omega sequence.DepositorTypeEmpty backboneExpressionPlantPromoter2xCaMV35S enhancer and omegaAvailable SinceOct. 14, 2016AvailabilityAcademic Institutions and Nonprofits only -
lenti sgRNA(MS2)_puro optimized backbone
Plasmid#73797Purposeoptimized lenti sgRNA cloning backbone with MS2 loops at tetraloop and stemloop 2 and EF1a-puro resistance marker. Contains BsmBI sites for insertion of spacer sequences.DepositorHas ServiceCloning Grade DNATypeEmpty backboneUseCRISPR and LentiviralExpressionMammalianPromoterU6 and EF1AAvailable SinceMarch 15, 2016AvailabilityAcademic Institutions and Nonprofits only -
Ntn1-Fc-His
Plasmid#72104PurposeExpresses the entire Netrin 1 protein, C-terminally fused to the Fc region of human IgG1 + 6X histidine tag.DepositorAvailable SinceMarch 1, 2016AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-FAM20C:V5
Plasmid#63584PurposeFAM20C can phosphorylate secreted phosphoproteins, and characterization of its activity identifies FAM20C as a Golgi casein kinase.DepositorAvailable SinceNov. 3, 2015AvailabilityAcademic Institutions and Nonprofits only -
pLGB36
Plasmid#135621PurposeSuicide vector for allelic replacement in Bacteroides species including B. fragilis strain 638R, erythromycin selection and aTC-inducible ss-Bfe3 counterselectionDepositorInsertbfe3
UseBacteroides suicide vector with inducible counter…Tagssignal sequence for periplasmic targetingPromoterBacteroides promoter regualted by TetR transcript…Available SinceJan. 22, 2020AvailabilityAcademic Institutions and Nonprofits only -
pDXinit
Plasmid#110101PurposeE.coli entry and expression vector for FX cloning system, N-terminal pelB signal sequence and C-terminal fusion to PIII for phage display using M13 phagesDepositorTypeEmpty backboneExpressionBacterialAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
p415 TEF Su9‐roGFP2‐Tsa2ΔCR
Plasmid#83240PurposeThe genetically encoded fluorescent H2O2 sensor roGFP2-Tsa2ΔCR cloned in the yeast p415 vector under the control of a TEF promoter. For mitochondrial matrix expression.DepositorInsertSu9-roGFP2-Tsa2dCr
TagsroGFP2 fusion with Tsa2dCr with Su9 targetting se…ExpressionYeastPromoterTEFAvailable SinceNov. 2, 2016AvailabilityAcademic Institutions and Nonprofits only -
pTrc99S-ssDsbA-CRM197-4xDQNAT
Plasmid#128403PurposePeriplasmic expression of CRM197 with C terminal 4xDQNAT glycosylation sites in E. coliDepositorInsertDiphtheria toxin
Tags4xDQNAT glycosylation tag, 6xHis tag, and DsbA si…ExpressionBacterialMutationInactivating G52E mutationPromotertrcAvailable SinceApril 13, 2021AvailabilityAcademic Institutions and Nonprofits only -
pH3mCHSH2
Plasmid#101053PurposeThis is a Cryptococcus neoformans mCherry expression vector with G418 drug selection marker and C. neoformans SH2 flanking sequences for genome integration.DepositorInsertCryptococcus mCherry expression plasmid
ExpressionYeastPromoterCryptococcus Histone3 promoterAvailable SinceOct. 26, 2017AvailabilityAcademic Institutions and Nonprofits only -
pSB1A3 EcoRI-RTX with EcoRI Methylase-AmilCP
Plasmid#85165PurposeProvides the coding region to express the EcoRI restriction enzyme. The RTX tag allows the EcoRI enzyme to be isolated via calcium-precipitation.DepositorInsertEcoRI-RTX and EcoRI Methylase-AmilCP coding sequences
TagsAmilCP and RTXExpressionBacterialPromoterJ23100 promoterAvailable SinceDec. 20, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pJM919_WT His POLI
Plasmid#201444PurposeLow copy vector for expressing human DNA polymerase iota in E. coli with an N-terminal 6x His tagDepositorInsertDNA polymerase iota (POLI Human)
Tags6x HisExpressionBacterialMutationCoding sequence has been optimised for expression…PromoterlacIqAvailable SinceNov. 8, 2023AvailabilityAcademic Institutions and Nonprofits only -
pLPCX mito Grx1-roGFP2
Plasmid#64977PurposeMammalian expression of mitochondrial Grx1-roGFP2 (retroviral vector)DepositorInsertGlutaredoxin-1 (GLRX Human)
UseRetroviralTagsroGFP2ExpressionMammalianMutationmitochondrial targeting sequenceAvailable SinceJune 17, 2015AvailabilityAcademic Institutions and Nonprofits only -
GFP-PS9
Plasmid#177944PurposeTransient mammalian expression of eGFP along with SARS-CoV-2 sequence 20080-21171 (PS9) within the 3'UTR. Resulting transcript is packaged into SARS-CoV-2 virus-like particles.DepositorInserteGFP (ORF1ab )
ExpressionMammalianAvailable SinceNov. 17, 2021AvailabilityAcademic Institutions and Nonprofits only -
lentiSAM v2 (Puro)
Plasmid#92062PurposeModified version of lentiSAM v2, a lenti sgRNA cloning backbone with MS2 loops at tetraloop/stemloop 2, dCas9-VP64, and puro resistance marker. Contains BsmBI sites for insertion of spacer sequences.DepositorTypeEmpty backboneUseCRISPR and LentiviralExpressionMammalianPromoterU6 (sgRNA) and EF1a (dCas9-VP64)Available SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pDD162 (Peft-3::Cas9 + Empty sgRNA)
Plasmid#47549PurposeCas9 + sgRNA plasmid that can be modified to cleave any Cas9 target site in the C. elegans genome.DepositorInsertsCas9
Empty sgRNA
UseCRISPRTagsHA and NLSExpressionWormMutationCodon optimized and with synthetic introns for C.…PromoterU6 and eef-1A.1 (eft-3)Available SinceSept. 9, 2013AvailabilityAcademic Institutions and Nonprofits only -
pRK5-FLAG-Sestrin2
Plasmid#72595PurposeoverexpressionDepositorInsertSESN2 (SESN2 Human)
TagsFLAGExpressionMammalianMutationcodon optimized for mammalian expression, see dep…PromoterCMVAvailable SinceFeb. 2, 2016AvailabilityAcademic Institutions and Nonprofits only -
pSBinit
Plasmid#110100PurposeE.coli entry and expression vector for FX cloning system, N-terminal pelB signal sequence and C-terminal myc and 6xHisTagDepositorTypeEmpty backboneTagsmyc, HisExpressionBacterialAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
pYES2/103Q
Plasmid#1385DepositorInserthuntingtin (103Q) (HTT Human)
TagsEGFP and FLAGExpressionYeastMutationExon1 sequences containing the first 17 amino aci…Available SinceFeb. 12, 2009AvailabilityAcademic Institutions and Nonprofits only