167,948 results
-
Plasmid#170864PurposeMammalian expression of dGFP-Rab3a.DepositorAvailable SinceJune 22, 2021AvailabilityAcademic Institutions and Nonprofits only
-
pAAV.Syn.GCaMP6m.WPRE.SV40 (AAV5)
Viral Prep#100841-AAV5PurposeReady-to-use AAV5 particles produced from pAAV.Syn.GCaMP6m.WPRE.SV40 (#100841). In addition to the viral particles, you will also receive purified pAAV.Syn.GCaMP6m.WPRE.SV40 plasmid DNA. Syn-driven GCaMP6m calcium sensor. These AAV preparations are suitable purity for injection into animals.DepositorPromoterSynAvailable SinceApril 17, 2018AvailabilityAcademic Institutions and Nonprofits only -
pENTR-GFP-MDC1 (770-7)
Plasmid#26284DepositorAvailable SinceOct. 18, 2010AvailabilityAcademic Institutions and Nonprofits only -
CRISPi Kit
Plasmid Kit#1000000136PurposeCRISPi Kit contains elements for CRISPR/Cas9 mediated genome editing in yeast P. pastoris. Contains 7 different backbone (BB3) vectors with Cas9/ sgRNA expression cassettes with NTC, hphMX, or kanMX.DepositorAvailable SinceAug. 27, 2018AvailabilityAcademic Institutions and Nonprofits only -
pGP-AAV-syn-FLEX-jGCaMP7f-WPRE (AAV PHP.eB)
Viral Prep#104492-PHPeBPurposeReady-to-use AAV PHP.eB particles produced from pGP-AAV-syn-FLEX-jGCaMP7f-WPRE (#104492). In addition to the viral particles, you will also receive purified pGP-AAV-syn-FLEX-jGCaMP7f-WPRE plasmid DNA. Syn-driven, Cre-dependent GCaMP7f calcium sensor. These AAV were produced with the PHPeB serotype, which permits efficient transduction of the central nervous system. These AAV preparations are suitable purity for injection into animals.DepositorPromoterSynAvailable SinceAug. 6, 2018AvailabilityAcademic Institutions and Nonprofits only -
lenti-SAM-hygro
Plasmid#138955PurposeLentiviral vector for co-expressing spCas9, dRNA-MS2, p65 and HSF1 fused to MS2 binding protein, and hygromycin resistance geneDepositorTypeEmpty backboneUseLentiviralExpressionMammalianPromoterU6 AND EF1aAvailable SinceAug. 28, 2020AvailabilityAcademic Institutions and Nonprofits only -
MAC_C_INSR
Plasmid#187772PurposeMAC-tagged gene expression of human INSRDepositorInsertINSR (INSR Human)
ExpressionMammalianAvailable SinceAug. 30, 2022AvailabilityAcademic Institutions and Nonprofits only -
pPB-CAG-hCas3
Plasmid#134920PurposeComponents for genome editing in mammalian cells with pCAG-All-in-one-hCascade and pBS-U6-crRNA-targeted.DepositorInsertCas3 with bpNLS
ExpressionMammalianPromoterCAGAvailable SinceJan. 3, 2020AvailabilityAcademic Institutions and Nonprofits only -
pHes1(2.5k)-luc
Plasmid#43806DepositorInsertHes1 Promoter (Hes1 Mouse)
UseLuciferaseTagsFirefly luciferaseExpressionMammalianMutationContains the murine Hes1 promoterPromoterHes1 PromoterAvailable SinceMarch 20, 2013AvailabilityAcademic Institutions and Nonprofits only -
PX552
Plasmid#60958PurposepAAV-U6sgRNA(SapI)_hSyn-GFP-KASH-bGH (SpGuide acceptor). AAV plasmid for sgRNA cloning. GFP-KASH fusion facilitates FACS sorting of cells and nuclei.DepositorInsertsU6_(SpaI)_sgRNA
Syn_EGFP-KASH
UseAAV, CRISPR, and Mouse TargetingExpressionMammalianPromoterSynapsin and U6Available SinceNov. 17, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCI-T7Max-UTR1-deGFP-8xHis-T500
Plasmid#178422PurposeExpression of deGFP via a T7 Promoter in TXTLDepositorInsertdeGFP
UseSynthetic BiologyTags8xHis TagExpressionBacterialPromoterT7MaxAvailable SinceDec. 15, 2021AvailabilityAcademic Institutions and Nonprofits only -
pSB1C3-J23110-B0034-mRFP1_Yellow
Plasmid#160443PurposeBioBrick pSB1C3 plasmid that constitutively overexpresses mRFP1_Yellow chromoprotein in E. coliDepositorInsertpromoter, RBS, mRFP1E_Yellow
UseSynthetic BiologyMutationBioBrick sites removedAvailable SinceJan. 20, 2021AvailabilityAcademic Institutions and Nonprofits only -
pLVX-Tight-Puro_Nkx6.2
Plasmid#64846PurposeA lentiviral vector for the expression of mouse Nkx6.2 under doxycyline controlDepositorAvailable SinceMay 28, 2015AvailabilityAcademic Institutions and Nonprofits only -
pNCS Citrine
Plasmid#91761PurposeBacterial expression of a fluorescent protein, CitrineDepositorInsertCitrine
TagsHexa-Histidine tag, Xpress epitope for detection …ExpressionBacterialPromoterT7Available SinceJune 9, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCI-EGFP-NR2a wt
Plasmid#45445DepositorInsertNR2A (Grin2a Rat)
TagsEGFPExpressionMammalianMutationEGFP inserted after the predicted signal peptide …PromoterCMVAvailable SinceJune 7, 2013AvailabilityAcademic Institutions and Nonprofits only -
SpCas9-CBE6b-V106W
Plasmid#215825PurposeExpress CBE6b V106W (with SpCas9) in mammalian cellsDepositorInsertCBE6b V106W-SpCas9-2xUGI (cas9 )
UseIn vitro transcription templateAvailable SinceMarch 8, 2024AvailabilityAcademic Institutions and Nonprofits only -
TFORF3358
Plasmid#144834PurposeLentiviral vector for overexpressing transcription factor ORFs with unique 24-bp barcodes. Barcodes facilitate identification of transcription factors in pooled screens.DepositorAvailable SinceAug. 14, 2023AvailabilityAcademic Institutions and Nonprofits only -
pEF1a-BirA-V5-neo
Plasmid#100548PurposeExpresses C-terminal V5-tagged BirA biotin ligaseDepositorInsertC-terminal V5-tagged BirA
TagsV5, HisExpressionMammalianPromoterHuman EF1aAvailable SinceSept. 7, 2017AvailabilityAcademic Institutions and Nonprofits only -
mCherry-cGAS-HA
Plasmid#231895PurposeExpression of cyclic GMP/AMP synthase (cGAS), as a nuclear rupture markerDepositorAvailable SinceFeb. 11, 2025AvailabilityAcademic Institutions and Nonprofits only -
pHCMV_COCVmut_G
Plasmid#207262PurposeMammalian expression of a mutant Cocal virus G proteinDepositorInsertCOCVmut_G
ExpressionMammalianMutationK47A/Y209A/R354A; mammalian codon optimizationPromoterCMV promoterAvailable SinceNov. 2, 2023AvailabilityAcademic Institutions and Nonprofits only -
pD649-HAsp-EDA-Fc(DAPA)-AviTag-6xHis
Plasmid#156768PurposeMammalian expression of cell-surface protein extracellular domain fused to Fc(DAPA)-Avi-6xHis. Protein is secreted from cells.DepositorInsertEDA (EDA Human)
TagsFc(DAPA)-AviTag-6xHisExpressionMammalianMutationFc region of human IgG contains D265A and P329A m…PromoterCMV/SP6Available SinceMarch 8, 2023AvailabilityAcademic Institutions and Nonprofits only -
pLv-CMV-MyoD-ER(T)
Plasmid#26809DepositorInsertMyoD-ER(T) (Myod1 Mouse)
UseLentiviralAvailable SinceSept. 12, 2011AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CaMKII-PinkyCaMP
Plasmid#232858PurposeAn AAV vector expressing the mScarlet based calcium indicator PinkyCaMP under CaMKII promoterDepositorInsertPinkyCaMP
UseAAVExpressionMammalianPromoterCaMKIIAvailable SinceFeb. 20, 2025AvailabilityAcademic Institutions and Nonprofits only -
Arf4-GFP
Plasmid#39556DepositorAvailable SinceSept. 10, 2012AvailabilityAcademic Institutions and Nonprofits only -
-
SPYtag-Histag-Avidin
Plasmid#214836PurposeThis plasmid encodes a protein (SPYtag-Histag-Avidin) that is used for generating functionalized magnetic beads for MagIC-cryo-EM, a method for single-particle cryo-EM analysis on magnetic beads.DepositorInsertSPYtag-Histag-Avidin
ExpressionBacterialPromoterT7Available SinceFeb. 20, 2024AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pgLAP4
Plasmid#19705DepositorInsertpgLAP4
TagsFlag, S peptide, and TevExpressionMammalianAvailable SinceApril 14, 2009AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-HDAC2-H141A
Plasmid#115346PurposeExpresses mouse HDAC2 cDNA with H141A point mutationDepositorInsertHistone deacetylase 2 (Hdac2 Mouse)
TagsFLAGExpressionMammalianMutationH141APromoterCMVAvailable SinceNov. 1, 2018AvailabilityAcademic Institutions and Nonprofits only -
CMVTO-SEAP-26Sfur-3TM-tevs-AAMP
Plasmid#179633PurposeSEAP RELEASE construct with AAMP motif controlDepositorInsertSEAP RELEASE
ExpressionMammalianAvailable SinceMarch 23, 2022AvailabilityAcademic Institutions and Nonprofits only