We narrowed to 31,648 results for: REP
-
Plasmid#51636PurposeMamamlian expression of 3xHA tagged reptin, N-terminal.DepositorAvailable SinceMay 19, 2014AvailabilityAcademic Institutions and Nonprofits only
-
pHS18 (mANGPTL3-Strep)
Plasmid#109111PurposeExpresses StrepII-tagged mouse ANGPTL3 in mammalian cellsDepositorAvailable SinceJune 5, 2018AvailabilityIndustry, Academic Institutions, and Nonprofits -
eGFP L202 Reporter
Plasmid#119129PurposeActs as a reporter for APOBEC-medated single-base editing. mCherry acts as a transfection control and eGFP as a reporter.DepositorInsertmCherry and eGFP
UseLentiviralMutationeGFP L202SPromoterCMVAvailable SinceJune 10, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCDNA4.TO-ORF57-2xCSTREP
Plasmid#136217PurposeExpresses C-terminally strep tagged Kaposi's Sarcoma Associated Herpesvirus (KSHV) ORF57DepositorInsertORF57
ExpressionMammalianPromoterCMVAvailable SinceJan. 3, 2020AvailabilityAcademic Institutions and Nonprofits only -
Annexin A7-TEV-TwinStrep
Plasmid#198635PurposeAnnexin A7 fibrillization and lipid bindingDepositorAvailable SinceSept. 29, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1_ 2xFLAG-2xSTREP_BACH1
Plasmid#159130Purposeexpresses BACH1 in mammalian cellsDepositorAvailable SinceSept. 21, 2020AvailabilityAcademic Institutions and Nonprofits only -
TRE reporter backbone
Plasmid#158678PurposeThis plasmid serves as the backbone for the TRE reporters described in our paper. It's a promoterless-mStrawberry-pGK-BSD backbone to which we insert a pathway specific promoter before the mStrawberryDepositorTypeEmpty backboneUseLentiviralTagsmStrawberryExpressionMammalianAvailable SinceMay 18, 2022AvailabilityAcademic Institutions and Nonprofits only -
pAB2076 pAAV REPAIR.t1
Plasmid#176323PurposepAAV EFS-HIVNES-dCas13bt1- (GGS)2-huADAR2(E488Q)-3xHA BGHpolyA::U6-BpiI-Cas13bt1 DR (full REPAIR.t1 + crRNA expression for AAV production)DepositorInsertshuman codon optimized Cas13bt1 (catalytically inactivated)
huADAR2dd(E488Q) (ADARB1 Human)
Cas13bt1 crRNA + BpiI cloning site
UseAAV and CRISPRTags3xHA and HIV NESExpressionMammalianMutationE488Q, only the deaminase domain (aa 276-702 are …PromoterEFS (short EF1alpha) and hU6Available SinceOct. 14, 2021AvailabilityAcademic Institutions and Nonprofits only -
pTLR repair vector
Plasmid#64322PurposeVector for repair of the traffic light reporter (TLR), providing the venus coding regionDepositorInsertVenus
UseArtificial targeting vectorMutationsee publication for detailsPromoternoneAvailable SinceMay 19, 2015AvailabilityAcademic Institutions and Nonprofits only -
TwinStrepSUMO-pvc10-Cas9
Plasmid#243755PurposeFor affinity purification of Pvc10 fused to Cas9DepositorInsertpvc10-Cas9
ExpressionBacterialAvailable SinceSept. 24, 2025AvailabilityAcademic Institutions and Nonprofits only -
CRISPR-SP-Cas9 reporter
Plasmid#62733PurposeMammalian CRISPR-SP-Cas9 reporterDepositorInsertCRISPR-SP-Cas9 target seq + tdTomato (out of frame)
UseCRISPR and LentiviralTagsCRISPR-SP-Cas9 target seq (hAAVS1 locus) and HA t…ExpressionMammalianPromoterEF1-AlphaAvailable SinceApril 24, 2015AvailabilityAcademic Institutions and Nonprofits only -
pET21-Streptavidin-K121R
Plasmid#89880PurposeStreptavidin that has unimpaired biotin binding after dye labelingDepositorInsertStreptavidin-K121R-Glutamate_Tag
Tags6 glutamate tag (C terminal on insert)ExpressionBacterialMutationK121RAvailable SinceAug. 9, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-2strep-FBH1
Plasmid#236464Purposetransient overexpression of FBH1 in mammalian cellsDepositorInsertFBH1 (FBXO18 Human)
ExpressionMammalianAvailable SinceMay 21, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1_ 2xFLAG-2xSTREP_KEAP1
Plasmid#159128Purposeexpresses KEAP1 in mammalian cellsDepositorAvailable SinceSept. 17, 2020AvailabilityAcademic Institutions and Nonprofits only -
7TFP CDH1 reporter
Plasmid#91704Purposelentiviral luciferase reporter containing CDH1 promoterDepositorInsertCDH1 promoter (CDH1 Human)
UseLentiviral and LuciferaseTagsluciferaseExpressionMammalianPromoterCDH1Available SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
FL MALT1 WT in pET29b-Strep
Plasmid#48968PurposeExpresses Full length wild type MALT1 in e.coliDepositorAvailable SinceNov. 6, 2013AvailabilityAcademic Institutions and Nonprofits only -
pCDNA4.TO-ORF64-2xNSTREP
Plasmid#136224PurposeExpresses N-terminally strep tagged Kaposi's Sarcoma Associated Herpesvirus (KSHV) ORF64DepositorInsertORF64
ExpressionMammalianPromoterCMVAvailable SinceJan. 9, 2020AvailabilityAcademic Institutions and Nonprofits only -
pTwist-CMV-HDGFL2_Cryptic_TwinstrepTEV_6xHis
Plasmid#232344PurposeExpresses human HDGFL2 protein with TDP-43 regulated cryptic exon, along with an N-terminal twinstrep tag + TEV protease site and C-terminal His-tagDepositorInsertHDGF Like 2 (HDGFL2 Human)
TagsGGGS linker, 6xHis and Twin-strep, TEV protease s…ExpressionMammalianMutationTDP-43 regulated cryptic exonAvailable SinceFeb. 21, 2025AvailabilityAcademic Institutions and Nonprofits only -
pLV-REPORT(PGK)
Plasmid#172328PurposeLV REPORT containing minimal promoter driving monomeric nuclear Tomato 2a HSVtk 2a Neo followed by an PGK promoter driving nuclear d2eGFP E2A HygromycinDepositorInsertsmonomeric nuclear Tomato
d2eGFP
HygR
UseLentiviral and Synthetic BiologyTags3x SV40 NLSExpressionMammalianPromoterPGKAvailable SinceJune 26, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5FRT/TO-SVIP-Strep-HA
Plasmid#113491PurposeExpression of human SVIP with C-terminal strep-HA tagDepositorInsertSVIP (SVIP Human)
Tags2xstrep-HAExpressionMammalianMutationwildtype without stop codonPromoterCMVAvailable SinceAug. 15, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5FRT/TO-UBXD7-Strep-HA
Plasmid#113479PurposeExpression of human UBXD7 with C-terminal strep-HA tagDepositorInsertUBXD7 (UBXN7 Human)
Tags2xstrep-HAExpressionMammalianMutationA834C silent mutation, wildtype without stop codonPromoterCMVAvailable SinceAug. 15, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pmiR-report-MYB-WT
Plasmid#141114PurposeReporter plasmid of WT MYB in mammalian cells.DepositorAvailable SinceOct. 13, 2020AvailabilityAcademic Institutions and Nonprofits only -
Dead Streptavidin-SpyTag
Plasmid#59548PurposepET21-DTag encodes Dead streptavidin (negligible biotin binding) bearing a C-terminal SpyTag, for generation of chimeric SpyAvidin tetramersDepositorInsertDead Streptavidin-SpyTag
TagsSpyTagExpressionBacterialMutationThe construct lacks final K of SpyTagPromoterT7Available SinceOct. 3, 2014AvailabilityAcademic Institutions and Nonprofits only -
pXT128_TwinStrep-SUMO-ShCas12k
Plasmid#135524PurposeProtein expression construct for ShCast12kDepositorInsertShCas12k
TagsTwinStrep-SUMOExpressionBacterialAvailable SinceDec. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1_ 2xFLAG-2xSTREP_FBXO22
Plasmid#159127Purposeexpresses FBXO22 in mammalian cellsDepositorAvailable SinceSept. 18, 2020AvailabilityAcademic Institutions and Nonprofits only -
pXT130_TwinStrep-SUMO-ShTnsC
Plasmid#135526PurposeProtein expression construct for ShTnsCDepositorInsertShTnsC
TagsTwinStrep-SUMOExpressionBacterialAvailable SinceDec. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA4/TO/Strep-HA-ZAKalpha_deltaCTD
Plasmid#141196PurposeExpresses Strep-HA-ZAKalpha_deltaCTD in mammalian cells, can be used to make inducible cell linesDepositorInsertMAP3K20 (MAP3K20 Human)
TagsStrep, HAExpressionMammalianMutationdeletion of last 27 amino acidsPromoterCMVAvailable SinceJune 5, 2020AvailabilityAcademic Institutions and Nonprofits only -
pBM-strep-UCP1
Plasmid#216207Purposefor expression of human strep-tagged UCP1 protein in BacMam systemDepositorAvailable SinceApril 22, 2024AvailabilityAcademic Institutions and Nonprofits only -
7i sgRNA for 4-μHOM reporter
Plasmid#113626PurposesgRNA/CAS9 expression plasmid to induce a 3’ double-strand break in the 4-μHOM reporter 8 nts. upstream from the microhomologyDepositorInsert7i sgRNA
UseCRISPRExpressionMammalianAvailable SinceAug. 13, 2018AvailabilityAcademic Institutions and Nonprofits only -
pSHDY*in_PpetE:BCD2:MrBBS:Strep
Plasmid#133973PurposeHeterologous, copper-inducible expression of (-)-α- bisabolol synthase from Matricaria recutita (MrBBS) in Synechocystis sp. PCC 6803. The MrBBS CDS is fused to a C-termial StrepII-tag.DepositorInsertMrBBS:StrepII
UseSynthetic BiologyTagsStrepIIExpressionBacterialMutationinserted gene is codon optimized for Synechocyst…PromoterPpetE:BCD2Available SinceApril 6, 2020AvailabilityAcademic Institutions and Nonprofits only -
pXT131_TwinStrep-SUMO-ShTniQ
Plasmid#135527PurposeProtein expression construct for ShTniQDepositorInsertShTniQ
TagsTwinStrep-SUMOExpressionBacterialAvailable SinceDec. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
pXT129_TwinStrep-SUMO-ShTnsB
Plasmid#135525PurposeProtein expression construct for ShTnsBDepositorInsertShTnsB
TagsTwinStrep-SUMOExpressionBacterialAvailable SinceDec. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
IQ-compete reporter (integrating)
Plasmid#247176PurposePlasmid for genomic integration of the IQ-compete reporter (GFP-TCS-Quencher-CL1) into the YPRCΔ15 locus of yeast cells.DepositorInsertGFP-TCS-Quencher-CL1
ExpressionYeastPromoterTEF1Available SinceNov. 5, 2025AvailabilityAcademic Institutions and Nonprofits only -
pLIB-Strep(II)(C)-CTR9
Plasmid#231725PurposeProtein expression in insect cellsDepositorAvailable SinceMay 2, 2025AvailabilityAcademic Institutions and Nonprofits only -
GB1-A11(2-88)-Strep
Plasmid#196214PurposeCodon-optimized bacterial expression plasmid. Expresses GB1-His6-TEV-A11(2-88)-Strep.DepositorAvailable SinceJuly 6, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCEP4-PDGFRA-reporter
Plasmid#136456PurposeMammalian fluorescent reporter plasmid for PDGFRA signaling.DepositorInsertsPDGFRalpha (PDGFRA Human)
Array of serum response elements (SRE) to drive destabilized GFP expression from a minimal promoter.
TagsExtracellular c-myc epitope tag, Signal peptide f…ExpressionMammalianPromoterCMV and Minimal promoter with artificial SRE enha…Available SinceJuly 9, 2020AvailabilityAcademic Institutions and Nonprofits only -
7h sgRNA for 4-μHOM reporter
Plasmid#113625PurposesgRNA/CAS9 expression plasmid to induce a 3’ double-strand break in the 4-μHOM reporter at the edge of the microhomology.DepositorInsert7h sgRNA
UseCRISPRExpressionMammalianAvailable SinceAug. 13, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5FRT/TO-Ufd1-Strep-HA
Plasmid#113474PurposeExpression of human Ufd1 with C-terminal strep-HA tagDepositorInsertUfd1 (UFD1 Human)
Tags2xstrep-HAExpressionMammalianMutationwildtype without stop codonPromoterCMVAvailable SinceAug. 14, 2018AvailabilityAcademic Institutions and Nonprofits only -
pHS15 (hANGPTL3-Strep)
Plasmid#109112PurposeExpresses StrepII-tagged human ANGPTL3 in mammalian cellsDepositorAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1(-)-HA-SrtAstrep (pKS77)
Plasmid#50030PurposeExpression of cytosolic S. pyogenes SrtA in mammalian cellsDepositorInsertSrtA(strep)
TagsHAExpressionMammalianPromoterpCMVAvailable SinceDec. 13, 2013AvailabilityAcademic Institutions and Nonprofits only -
gRNA-eGFP-Reporter
Plasmid#60719PurposeExpresses guide RNA used to activate pGL3-Basic-8x-gRNA-eGFP reporter.DepositorInsertgRNA (5'-AAAGGTCGAGAAACTGCAAA-3')
UseCRISPRExpressionMammalianPromoterU6 and mouse U6Available SinceJan. 30, 2015AvailabilityAcademic Institutions and Nonprofits only -
pPPI4-Strep-SNAP-PD-1
Plasmid#223569PurposeProtein purification of human PD-1 with Twin-Strep and SNAP tags from mammalian cellsDepositorAvailable SinceSept. 3, 2024AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5FRT/TO-SAKS1-Strep-HA
Plasmid#113487PurposeExpression of human SAKS1 with C-terminal strep-HA tagDepositorInsertSAKS1 (UBXN1 Human)
Tags2xstrep-HAExpressionMammalianMutationwildtype without stop codonPromoterCMVAvailable SinceAug. 15, 2018AvailabilityAcademic Institutions and Nonprofits only -
pET15b-ALFA-TwinStrep
Plasmid#240252PurposeIPTG-inducible plasmid with thermostable GFP (TGP) and Twin-Strep tagsDepositorTypeEmpty backboneTags10x HIS, ALFA, Thrombin, and Twin-StrepExpressionBacterialPromoterT7Available SinceJuly 24, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-StrepHA-SUMO2
Plasmid#66867PurposeMammalian expression of SUMO2 with a strep and an HA tagDepositorAvailable SinceJune 22, 2015AvailabilityAcademic Institutions and Nonprofits only -
pcDNA4/TO/Strep-HA-ZAKalpha_deltaSdeltaCTD
Plasmid#141198PurposeExpresses Strep-HA-ZAKalpha_deltaSdeltaCTD in mammalian cells, can be used to make inducible cell linesDepositorInsertMAP3K20 (MAP3K20 Human)
TagsStrep, HAExpressionMammalianMutationdeletion of last 27 amino acids and amino acids 6…PromoterCMVAvailable SinceJune 19, 2020AvailabilityAcademic Institutions and Nonprofits only -
eGFP L138 Reporter
Plasmid#119130PurposeActs as a reporter for APOBEC-medated single-base editing. mCherry acts as a transfection control and eGFP as a reporter.DepositorInsertmCherry and eGFP
UseLentiviralMutationeGFP L138SPromoterCMVAvailable SinceJune 10, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5FRT/TO-UBXD4-Strep-HA
Plasmid#113480PurposeExpression of human UBXD4 with C-terminal strep-HA tagDepositorInsertUBXD4 (UBXN2A Human)
Tags2xstrep-HAExpressionMammalianMutationwildtype without stop codonPromoterCMVAvailable SinceAug. 15, 2018AvailabilityAcademic Institutions and Nonprofits only -
pTwist-CMV-HDGFL2_WT_TwinstrepTEV_6xHis
Plasmid#232343PurposeExpresses wild-type human HDGFL2 protein with an N-terminal twinstrep tag + TEV protease site and C-terminal His-tagDepositorInsertHDGF like 2 (HDGFL2 Human)
TagsGGGS linker, 6xHis and Twin-strep, TEV protease s…ExpressionMammalianAvailable SinceFeb. 11, 2025AvailabilityAcademic Institutions and Nonprofits only