We narrowed to 22,610 results for: ESC
-
Plasmid#56117PurposeLocalization: Cytoskeleton, Excitation: 580, Emission: 608DepositorAvailable SinceApril 1, 2015AvailabilityIndustry, Academic Institutions, and Nonprofits
-
pcDNA3.4_CEACAM6-His
Plasmid#149337Purposefor eukaryotic expression and purification of CEACAM6-His6DepositorInsertCEACAM6 (CEACAM6 Human)
TagsIL-2 signal peptide and polyhistidineExpressionMammalianMutationpoint mutation (GGA to GCA) to replace 'G-g…PromoterCMVAvailable SinceOct. 28, 2020AvailabilityAcademic Institutions and Nonprofits only -
pAAV-hSyn-R-iLACCO1.2
Plasmid#208101PurposeBiosensor for intracellular L-lactateDepositorInsertR-diLACCO1
UseAAVAvailable SinceNov. 14, 2023AvailabilityAcademic Institutions and Nonprofits only -
pAAV.hSyn.iGluSnFr.WPRE.SV40
Plasmid#98929PurposeAAV expression of glutamate sensor from human synapsin promoter. ** A newer version of this sensor is available. Please see iGluSnFR3 plasmids at https://www.addgene.org/browse/article/28220233/ **DepositorHas ServiceAAV1, AAV5, and AAV9InsertiGluSnFr
UseAAVExpressionMammalianPromoterhSynAvailable SinceJan. 31, 2018AvailabilityAcademic Institutions and Nonprofits only -
TPC2-mCherry
Plasmid#135183PurposeExpresses TPC2 with C-terminus mCherry tag in mammalian cellsDepositorAvailable SinceJan. 14, 2020AvailabilityAcademic Institutions and Nonprofits only -
pCA528 IST1 (1-366)
Plasmid#193039PurposeBacterial expression plasmid for full-length IST1 (1-366).DepositorAvailable SinceDec. 9, 2024AvailabilityAcademic Institutions and Nonprofits only -
pC3.1_CMV_oROS-G_LF(C199S)
Plasmid#216112PurposeExpresses the loss-of-function mutations C199S of the genetically encoded green fluorescent hydrogen peroxide sensor oROS-G in mamalian cells.DepositorInsertoROS-G_LF(C199S)
ExpressionMammalianPromoterCMVAvailable SinceMay 28, 2024AvailabilityAcademic Institutions and Nonprofits only -
pLenti NL
Plasmid#113450PurposeLentiviral NanoLuc control expression vectorDepositorInsertNanoLuc
UseLentiviral and LuciferaseTagscmycExpressionMammalianPromoterhUbCAvailable SinceAug. 14, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-ULK2
Plasmid#97075PurposeExpresses ULK2 in mammalian cellsDepositorAvailable SinceAug. 16, 2017AvailabilityAcademic Institutions and Nonprofits only -
LENTICRISPR-UPP1_sgRNA1
Plasmid#201634PurposeCRISPR/Cas9-mediated gene knock-outDepositorInsertUPP1 (UPP1 Human)
UseCRISPR and LentiviralAvailable SinceJune 22, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
PIK3CA - Exon9 E545K
Plasmid#16642DepositorAvailable SinceMarch 10, 2008AvailabilityAcademic Institutions and Nonprofits only -
px458_2A_GFP_sgRNA_LTN1
Plasmid#127125DepositorInsertgRNA LTN1 (LTN1 Human)
UseCRISPRAvailable SinceJuly 25, 2019AvailabilityAcademic Institutions and Nonprofits only -
pRDB_053
Plasmid#216083Purposefor transgenic flies; gypsy insulator sequences; white+ selectable marker; attB site for genome integration by phiC31, destination vectorDepositorHas ServiceCloning Grade DNAInsertgypsy insulator sequences; white+ selectable marker; attB site for genome integration by phiC31
UseDestinationExpressionInsectAvailable SinceApril 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
pTRE3G-Bi-gePSI-pCamk2a-AcGFP
Plasmid#133732PurposeExpresses both the gePSI-α-chain and the gePSI-β-chain under control of the inducible bi-directional TRE3G promoter. Expresses constitutively AcGFP under control of a Camk2a promoter.DepositorInsertsgePSI-β-chain
gePSI-α-chain
AcGFP1
UseAAVTagsmurine ornithine decarboxylase - degron (ODC36)ExpressionMammalianPromoterpCamk2a and pTRE3G-BiAvailable SinceDec. 18, 2019AvailabilityAcademic Institutions and Nonprofits only -
mLama1 AAV sgRNA 1, 2, 5
Plasmid#135339PurposeExpression plasmid of VP64-SadCas9 sgRNA 1, 2 and 3DepositorInsertLama1 VP64-dCas9 sgRNA Guides
UseAAVTagsEGFPExpressionMammalianPromoterCMVAvailable SinceMarch 11, 2020AvailabilityAcademic Institutions and Nonprofits only -
TRRAP sgRNA3
Plasmid#138184Purpose3rd generation lentiviral gRNA plasmid targeting human TRRAPDepositorAvailable SinceMarch 18, 2020AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CAG-mBaoJin-P2A-mCherry
Plasmid#229601PurposeExpresses mBaoJin and mCherry in mammalian cellsDepositorInsertmBaoJin
UseAAVExpressionMammalianAvailable SinceJuly 17, 2025AvailabilityAcademic Institutions and Nonprofits only -
TPC1-mCherry
Plasmid#135182PurposeExpresses TPC1 with C-terminus mCherry tag in mammalian cellsDepositorAvailable SinceDec. 20, 2019AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CAG-mGreenLantern
Plasmid#164469PurposeConstitutive CAG-driven expression of mGreenLantern in animals using AAVDepositorInsertmGreenLantern
UseAAVExpressionMammalianMutationClover-F64L/S72A/E124V/N149K/I167T/S175G/A206K/L2…PromoterCAGAvailable SinceMarch 1, 2021AvailabilityAcademic Institutions and Nonprofits only -
LSB-hsa-let-7a-5p
Plasmid#103146PurposeUsed to sense miRNA activity using fluorescence based tools. hsa-let-7a-5p target in 3' UTR of of mKate. miRNA activity can be measured by the repression of mKate2 relative to EBFP2 fluorescent proteins . Plasmid is inherently unstable; please see Depositor CommentsDepositorInserthsa-let-7a-5p target
UseSynthetic BiologyExpressionMammalianPromoterEF-1aAvailable SinceNov. 26, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-Lyso-Digda
Plasmid#236102PurposeLysosome-targeted FRET-based biosensor for monitoring diacylglycerol (DAG) dynamics in living cells.DepositorAvailable SinceJune 3, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1(+)-PM-RasAR
Plasmid#205569PurposePlasma membrane-targeted RasAR.DepositorInsertPM-RasAR (RAF1 Synthetic, Human)
TagsN-terminal targeting sequence from Lyn kinaseExpressionMammalianPromoterCMVAvailable SinceOct. 2, 2023AvailabilityAcademic Institutions and Nonprofits only -
mOrange2-Fibrillarin-7
Plasmid#57957PurposeLocalization: Nucleus/Nucleoli, Excitation: 549, Emission: 565DepositorAvailable SinceOct. 24, 2014AvailabilityAcademic Institutions and Nonprofits only -
pAAV.CAG.(ER).iGlucoSnFR2.H348H.HaloTag
Plasmid#244074PurposeER expression of green glucose sensor (high affinity) with non-responsive HaloTagDepositorInsertiGlucoSnFR2.H348H.HaloTag
UseAAVTagsCalreticulin and HaloTagAvailable SinceSept. 23, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV.CAG.(cyto).iGlucoSnFR2.H348H.HaloTag
Plasmid#244070PurposeCytosolic expression of green glucose sensor (high affinity) with non-responsive HaloTagDepositorInsertiGlucoSnFR2.H348H.HaloTag
UseAAVTagsHaloTagAvailable SinceSept. 23, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV.TBG.(cyto).iGlucoSnFR2.mIRFP670nano3
Plasmid#244103PurposeCytosolic expression of green glucose sensor with non-responsive mIRFPDepositorInsertiGlucoSnFR2.mIRFP670nano3
UseAAVAvailable SinceSept. 23, 2025AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-N1_MeCP2(WT)
Plasmid#110186PurposeExpression of mouse MeCP2 (WT) in mammalian cellsDepositorInsertMeCP2_e2 FL (mouse cDNA) (Mecp2 Mouse)
TagsEGFPExpressionMammalianMutationwild typePromoterCMVAvailable SinceMay 16, 2018AvailabilityAcademic Institutions and Nonprofits only -
Str-Ii_SBP-EGFP-Golgin84
Plasmid#65303Purposesynchronize trafficking of Golgin-84 from the ER (RUSH system)DepositorInsertGolgin-84 (GOLGA5 Human)
TagsEGFP and Streptavidin Binding Protein (SBP)ExpressionMammalianPromoterCMVAvailable SinceAug. 3, 2015AvailabilityAcademic Institutions and Nonprofits only -
-
Str-KDEL_SBP-mCherry-CCR1
Plasmid#222311PurposeSynchronize the trafficking of CCR1 from the ER.DepositorInsertStreptavidin-KDEL and CCR1 fused to SBP-mCherry (CCR1 Human)
ExpressionMammalianPromoterCMVAvailable SinceFeb. 4, 2025AvailabilityAcademic Institutions and Nonprofits only -
pLM-mCerulean-cMyc
Plasmid#23244DepositorInsertmCerulean-2A-MYC (MYC synthetic fluorescent protein, Human)
UseLentiviralAvailable SinceFeb. 5, 2010AvailabilityAcademic Institutions and Nonprofits only -
AAV-hSyn-SpdCas9-W3SL
Plasmid#210708PurposeThis Plasmid express hSyn promoter driven SpdCas9DepositorInsertS. Pyogenes dCas9
UseAAV and CRISPRTagsFLAGExpressionMammalianMutationD10A/H840APromoterhSynAvailable SinceNov. 29, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCMV-GalT-mCherry
Plasmid#214271PurposeMammalian expression of GalT-mCherry (Golgi marker)DepositorAvailable SinceFeb. 21, 2024AvailabilityAcademic Institutions and Nonprofits only -
pCVL.SSA TLR (Sce)
Plasmid#45576PurposeCodes for the SSA-TLR with the target site for I-Sce I in a lentiviral backboneDepositorInserts5' iRFP arm
eGFP with I-Sce I TS
+3 mCherry
3' iRFP arm
UseLentiviralExpressionBacterial and MammalianMutationembedded I-Sce I TS from 163-185bp, truncated 25 …PromoterSFFVAvailable SinceNov. 4, 2013AvailabilityAcademic Institutions and Nonprofits only -
alpha-0 CFP in pcDNA3.1
Plasmid#36396DepositorInsertG protein alpha 0 (Gnao1 Rat)
TagsCFPExpressionMammalianMutationCFP inserted into the KpnI-SpeI sites engineered …PromotercmvAvailable SinceFeb. 7, 2013AvailabilityAcademic Institutions and Nonprofits only -
pCMV-mGold2t-Tubulin-C-18
Plasmid#231779PurposeVisualization of tubulin in mammalian cells using mGold2tDepositorAvailable SinceMarch 17, 2025AvailabilityAcademic Institutions and Nonprofits only -
pLM-mCherry-Klf4
Plasmid#23243DepositorInsertmCherry_2A_KLF4 (KLF4 synthetic fluorescent protein, Human)
UseLentiviralAvailable SinceFeb. 5, 2010AvailabilityAcademic Institutions and Nonprofits only -
mRuby2-Calreticulin-N-16
Plasmid#55892PurposeLocalization: Endoplasmic Reticulum, Excitation: 559, Emission: 600DepositorAvailable SinceMarch 10, 2015AvailabilityIndustry, Academic Institutions, and Nonprofits -
p20StAD
Plasmid#190268PurposeConstitutively expresses a protein of interest fused to a GAL4 transcription activating domain. Targeted integration to genomic locus YPRC-delta15, Chromosome XVI.DepositorTypeEmpty backboneUseSynthetic Biology; Yeast genome-integrating vectorTagsGAL4-ADPromoterTDH3Available SinceNov. 15, 2022AvailabilityAcademic Institutions and Nonprofits only -
pUPD2 RDF ( GB1498)
Plasmid#160579PurposeStreptomyces phage PhiC31-encoded recombination directionality factor (RDF) (PhiC31 gp3)DepositorInsertRDF
UseSynthetic BiologyMutationBsaI and BsmBI sites removedAvailable SinceJan. 14, 2021AvailabilityAcademic Institutions and Nonprofits only -
pJBEI-6410
Plasmid#47049PurposeBglBrick plasmid (=pBbA5a-MTSAe-T1f-MBI(f)-T1002i-Ptrc-trGPPS(co)-LS) coding for MEV pathway enzymes to produce limonene from glucose in E. coliDepositorInsertCodon-optimized sequences for MEV pathway expression in E. coli to produce limonene
UseSynthetic Biology; BglbrickExpressionBacterialPromoterPlacUV5Available SinceSept. 12, 2013AvailabilityAcademic Institutions and Nonprofits only -
pAcBac1.tR4-AcdRS82
Plasmid#174101PurposeExpression of orthogonal Mb tRNA and Acd82 tRNA synthetase for incorporation of acridone in eukaryotic cells.DepositorInsertM. barkeri tRNA synthetase for acridone82
ExpressionMammalianMutationN311S, C313G, V366A, W382TPromoterCMVAvailable SinceNov. 19, 2021AvailabilityAcademic Institutions and Nonprofits only -
hHS1-M7A
Plasmid#159170PurposeHuman codon-optimized cytosolic labile heme reporterDepositorInserthHS1-M7A
ExpressionMammalianMutationMutated Met 7 of the cyt b562 module of hHS1 to A…PromoterCMVAvailable SinceSept. 29, 2020AvailabilityAcademic Institutions and Nonprofits only -
pAAV_hSyn-fDIO-somQuasAr6a-EGFP-P2A-sombC1C2TG
Plasmid#183537PurposeVoltage indicatorDepositorInsertsomQuasAr6a-EGFP-P2A-sombC1C2TG
UseAAVMutationNonePromoterhSynAvailable SinceFeb. 9, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCMV-mGold2s-Tubulin-C-18
Plasmid#231771PurposeVisualization of tubulin in mammalian cells using mGold2sDepositorAvailable SinceMarch 17, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCMV-Myc CDC4 WT*
Plasmid#16652DepositorInsertCDC4 (FBXW7 Human)
TagsmycExpressionMammalianMutation*Note that this insert is only WT relative to the…Available SinceMarch 12, 2008AvailabilityAcademic Institutions and Nonprofits only -
AA183
Plasmid#216025PurposeFragmid fragment: (Cas protein) for prime editing; R221K;N394K for increased efficiencyDepositorHas ServiceCloning Grade DNAInsertnCas9 (H840A)_v2.1 [Sp]
UseCRISPR; FragmentAvailable SinceApril 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
LSB-hsa-let-7f-5p
Plasmid#103156PurposeUsed to sense miRNA activity using fluorescence based tools. hsa-let-7f-5p target in 3' UTR of of mKate. miRNA activity can be measured by the repression of mKate2 relative to EBFP2 fluorescent proteins . Plasmid is inherently unstable; please see Depositor CommentsDepositorInserthsa-let-7f-5p target
UseSynthetic BiologyExpressionMammalianPromoterEF-1aAvailable SinceNov. 26, 2018AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-PTK7-VSV
Plasmid#65250PurposeExpression of VSV tagged PTK7 in mammalian cellsDepositorAvailable SinceNov. 7, 2016AvailabilityAcademic Institutions and Nonprofits only