173,387 results
-
Plasmid#217490PurposeRADARSv3 driving mNeonGreenDepositorInsertmNeon
ExpressionMammalianAvailable SinceSept. 3, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CMV-FLEX-SaCas9-U6-sgSlc32a1
Plasmid#159905PurposeMutagenesis of Slc32a1DepositorInsertSlc32a1 (Slc32a1 Mouse)
UseAAV, CRISPR, and Mouse TargetingAvailable SinceNov. 16, 2020AvailabilityAcademic Institutions and Nonprofits only -
pSLS.492
Plasmid#184957PurposeTest effect of a1/a2 length on editing rpoB using retron recombineeringDepositorInsertEco1 RT and recombineering ncRNA, rpoB T1534C, a1/a2 length: 22
ExpressionBacterialMutationrpoB donor T1534C, a1/a2 length extended to 22 bpPromoterT7/lacAvailable SinceNov. 4, 2022AvailabilityAcademic Institutions and Nonprofits only -
Blimp1pGL3 (Human Blimp1 promoter in pGL3-basic)
Plasmid#40340DepositorInsertBlimp1 promoter (PRDM1 Human)
UseLuciferaseTagsLuciferaseExpressionMammalianPromoterBlimp1Available SinceOct. 12, 2012AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CKIIa-stGtACR2-FusionRed (AAV Retrograde)
Viral Prep#105669-AAVrgPurposeReady-to-use AAV Retrograde particles produced from pAAV-CKIIa-stGtACR2-FusionRed (#105669). In addition to the viral particles, you will also receive purified pAAV-CKIIa-stGtACR2-FusionRed plasmid DNA. CaMKIIa-driven, soma-targeted anion-conducting channelrhodopsin fused to FusionRed for optogenetic inhibition. These AAV were produced with a retrograde serotype, which permits retrograde access to projection neurons. These AAV preparations are suitable purity for injection into animals.DepositorPromoterCaMKIITagsFusionRedAvailable SinceJuly 8, 2020AvailabilityAcademic Institutions and Nonprofits only -
-
CD40L-SrtA
Plasmid#121167PurposepMP71 vector expressing Tomato - P2A - CD40L - SrtA - flagDepositorInsertCD40L-SrtA
UseRetroviralTagsTomato and flagExpressionMammalianAvailable SinceFeb. 27, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pBAD/His-miRFP670nano
Plasmid#127427PurposeMonomeric near-infrared fluorescent protein miRFP670nano in bacterial plasmidDepositorInsertmiRFP670nano
TagsHisExpressionBacterialPromoteraraCAvailable SinceJuly 17, 2019AvailabilityAcademic Institutions and Nonprofits only -
pAAV-Ef1a-Con/Foff 2.0-BFP (AAV8)
Viral Prep#137130-AAV8PurposeReady-to-use AAV8 particles produced from pAAV-Ef1a-Con/Foff 2.0-BFP (#137130). In addition to the viral particles, you will also receive purified pAAV-Ef1a-Con/Foff 2.0-BFP plasmid DNA. EF1a-driven, Cre-dependent expression of BFP (inhibited in the presence of Flp recombinase). These AAV preparations are suitable purity for injection into animals.DepositorPromoterEF1aTagsBFP (Cre-dependent)Available SinceMarch 19, 2021AvailabilityAcademic Institutions and Nonprofits only -
pU6-Sp-pegRNA-RNF2_+5GtoT
Plasmid#135957PurposeS. pyogenes pegRNA for +5 G to T edit at the RNF2 site of human cells using prime editingDepositorInsertRNF2_5GtoT pegRNA
ExpressionMammalianMutationSee manuscriptPromoterU6Available SinceJan. 2, 2020AvailabilityAcademic Institutions and Nonprofits only -
pREP-8xARE-GFP-SV40-BFP
Plasmid#134910PurposeNRF2 reporter plasmid with GFP under control of 8 ARE elements and constitutively transcribed BFPDepositorInserts8xARE- minimal promoter - GFP
TagBFP
ExpressionMammalianPromoter8xARE - minimal promoter and SV40Available SinceJan. 9, 2020AvailabilityAcademic Institutions and Nonprofits only -
pci-EGFP-UPF1-WT
Plasmid#135994PurposeWT UPF1 inserted with GFP tagged on the N-terminus used to stably integrate into cellsDepositorInsertUPF1
TagsEGFPExpressionMammalianAvailable SinceFeb. 21, 2020AvailabilityAcademic Institutions and Nonprofits only -
pLV-EF1A-CD19.28H.28TM.BB.3z
Plasmid#200679PurposeModular CD28hinge-CD28transmembrane-41BB-CD3z CAR backbone, For Transient Expression or Lentiviral ProductionDepositorUseLentiviralTagsMycTagExpressionMammalianPromoterEF1a-shortAvailable SinceNov. 6, 2023AvailabilityAcademic Institutions and Nonprofits only -
pUCmini-iCAP-PHP.N
Plasmid#127851Purposenon-standard AAV2 rep-AAV-PHP.N cap plasmid with AAV cap expression controlled by a tTA-TRE amplification systemDepositorInsertSynthetic construct isolate AAV-PHP.N VP1 gene
UseAAVExpressionMammalianPromoterp41Available SinceApril 21, 2020AvailabilityAcademic Institutions and Nonprofits only -
pRK5-HA-Parkin
Plasmid#17613DepositorAvailable SinceApril 3, 2008AvailabilityAcademic Institutions and Nonprofits only -
pHAGE-TO-dCas9
Plasmid#75381PurposedCas9DepositorInsertSp dCas9
UseLentiviralTagsnoExpressionMammalianPromoterCMV-TOAvailable SinceMay 25, 2016AvailabilityAcademic Institutions and Nonprofits only -
pAG87 FAST
Plasmid#130719PurposeExpresses His-tagged FAST (also called YFAST) in bacteriaDepositorInsertFAST
TagsHis-tagExpressionBacterialPromoterT7Available SinceSept. 13, 2019AvailabilityAcademic Institutions and Nonprofits only -
pAAV-hSyn-miniDi-P2A-mCherry
Plasmid#204358PurposeAAV vector for miniDi expression under the control of human synapsin promoterDepositorInsertminiDi-P2A-mCherry
UseAAVTagsmCherryMutationThe third intracellular loop (ICL3) of hM4Di was …PromoterhSynAvailable SinceOct. 22, 2024AvailabilityAcademic Institutions and Nonprofits only -
pBEST-OR2-OR1-Pr-UTR1-deGFP-T500
Plasmid#40019DepositorInsertdeGFP
ExpressionBacterialPromoterOR2-OR1-Pr (bacteriophage Lambda with one mutatio…Available SinceOct. 1, 2012AvailabilityAcademic Institutions and Nonprofits only -
AiP13997 - pAAV-AiE0410m-minBG-iCre(R297T)-BGHpA (Alias: CN3997)
Plasmid#230388PurposeAiE0410m is an enhancer sequence, designed to drive AAV-mediated transgene expression in specific populations of brain cellsDepositorInsertiCre(R297T)
UseAAVPromoterminBGAvailable SinceFeb. 24, 2025AvailabilityAcademic Institutions and Nonprofits only -
pENN.AAV.CMVs.TurboRFP.WPRE.RBG (AAV8)
Viral Prep#105548-AAV8PurposeReady-to-use AAV8 particles produced from pENN.AAV.CMVs.TurboRFP.WPRE.RBG (#105548). In addition to the viral particles, you will also receive purified pENN.AAV.CMVs.TurboRFP.WPRE.RBG plasmid DNA. CMV-driven TurboRFP expression. These AAV preparations are suitable purity for injection into animals.DepositorPromoterCMVTagsTurboRFPAvailable SinceJune 29, 2018AvailabilityAcademic Institutions and Nonprofits only -
pmIL-6promoterEGFP
Plasmid#112896PurposeTo monitor the activation of the murine IL-6 promoter by eGFP expressionDepositorAvailable SinceSept. 18, 2018AvailabilityAcademic Institutions and Nonprofits only -
lentiGuide-Crimson
Plasmid#70683PurposeExpresses S. pyogenes CRISPR chimeric RNA element with customizable sgRNA from U6 promoter and Crimson reporter from EF-1a promoter. Lentiviral backbone.DepositorInsertsS. pyogenes sgRNA cassette
Crimson Reporter
UseCRISPR and LentiviralExpressionMammalianPromoterEf1-a and hU6Available SinceFeb. 16, 2016AvailabilityAcademic Institutions and Nonprofits only -
TRUPATH Triple Gai3
Plasmid#196050PurposeEncodes a G alpha subunit (GNAl3) with RLuc8, a G gamma subunit (GNG9) with GFP2 and a G beta subunit (GNB3) as optimal components of a BRET2 biosensor for studying heterotrimeric G proteinsDepositorUseLuciferaseTagsGFP2 and GSAG linkerExpressionMammalianMutationRLuc8 and flanking SGGGGS linkers have been inser…PromoterCMVAvailable SinceFeb. 27, 2023AvailabilityAcademic Institutions and Nonprofits only -
pmCherry-EGFP
Plasmid#86639PurposeExpresses mCherry-eGFP tandem (cytoplasmic)DepositorInsertmCherry-EGFP
TagsmCherry-EGFPExpressionMammalianAvailable SinceApril 5, 2017AvailabilityAcademic Institutions and Nonprofits only -
pLVX-TetOne-Puro-mitoLbNOX-Flag
Plasmid#234985PurposeExpresses mitochondrial LbNOX in human cell linesDepositorInsertmito-LbNOX
UseLentiviralTagsFlagExpressionMammalianAvailable SinceApril 22, 2025AvailabilityAcademic Institutions and Nonprofits only -
pH2B-Electra2
Plasmid#179479PurposeNuclear labeling with blue fluorescent protein Electra2 fused to H2BDepositorInsertH2B-Electra2
TagsElectra2ExpressionMammalianPromoterCMVAvailable SinceAug. 10, 2022AvailabilityAcademic Institutions and Nonprofits only -
iF59 PB-TO-oNgn2-puro
Plasmid#204734PurposeImproved Dox-inducible neurogenin-2; Piggybac Tet-ON plasmid for differentiating hiPSCs into glutamatergic neurons via NGN2 expression. oNGN2 is a Phospho-mutant which avoids inhibition by cdk kinase.InsertOptimized neurogenin-2
ExpressionMammalianAvailable SinceAug. 7, 2023AvailabilityAcademic Institutions and Nonprofits only -
Flag-HA-GFP
Plasmid#22612DepositorInsertGFP
UseRetroviralTagsFLAG and HAExpressionMammalianMutationNoneAvailable SinceDec. 4, 2009AvailabilityAcademic Institutions and Nonprofits only -
pMRX-hSTING-EGFP
Plasmid#214149PurposeRetroviral transduction of EGFP-tagged STINGDepositorAvailable SinceApril 5, 2024AvailabilityAcademic Institutions and Nonprofits only -
pAAV-mCherry-flex-dtA
Plasmid#58536PurposeExpresses diphtheria toxin A subunit in Cre positive cells, and mCherry in all the infected cellsDepositorAvailable SinceAug. 22, 2014AvailabilityAcademic Institutions and Nonprofits only -
eGFP-ova-C1
Plasmid#163524PurposeExpresses both eGFP and chicken ovalbumin in mammalian cellsDepositorInsertenhanced-GFP-chicken ovalbumin tandem
TagseGFPExpressionMammalianPromoterCMVAvailable SinceJan. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pAAV-hSyn1-FLEX-CybSEP2-WPRE
Plasmid#207661PurposeMonitoring neuropeptide releaseDepositorInsertCytochrome b-561 (Cyb561 Mouse)
UseAAVMutationHistidine 86 and 159 to alanines, inserted 2 X SE…PromoterhSynapsinAvailable SinceDec. 5, 2023AvailabilityAcademic Institutions and Nonprofits only -
pAG247 His-iFAST
Plasmid#130808PurposeExpresses His-tagged iFAST in bacteriaDepositorInsertiFAST
TagsHis-tagExpressionBacterialPromoterT7Available SinceSept. 13, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCAG-HA-Nrxn1beta AS4(-)
Plasmid#59409PurposeExpression plasmid for HA-tagged mouse Neurexin 1beta AS4(-) [lacking the insert at alternatively spliced segment 4 (AS4-)]DepositorAvailable SinceJune 11, 2015AvailabilityAcademic Institutions and Nonprofits only -
pcs2-GFP-IRES-mCherry
Plasmid#226098PurposeProtein stability reporter construct for transient expression in mammalian cells. Stability of GFP-fusion protein can be assed by flow cytometry by normalizing to mCherry expression.DepositorTypeEmpty backboneExpressionMammalianAvailable SinceOct. 8, 2024AvailabilityAcademic Institutions and Nonprofits only -
qTAG-C-Solo-mStayGold-TOMM20
Plasmid#227307PurposeDonor template for mStayGold insertion into the C-terminus of the TOMM20 locus. For mitochondria visualization. To be co-transfected with sgRNA plasmid px330-PITCh-TOMM20 (Addgene #207789)DepositorInsertTOMM20 Homology Arms flanking a mStayGold Tag (TOMM20 Human)
UseCRISPR; Donor templateExpressionMammalianPromoterPromoterlessAvailable SinceNov. 25, 2024AvailabilityAcademic Institutions and Nonprofits only -
pEGFP - FLAG-APEX2- hs Lamin B1
Plasmid#139442PurposeAPEX2-Lamin B1 expression plasmidDepositorInsertLMNB1 (LMNB1 Human)
Tags3xGGGGS linker (between APEX2 and Lamin B1), APEX…ExpressionMammalianPromoterCMVAvailable SinceMay 13, 2020AvailabilityAcademic Institutions and Nonprofits only -
FNLCR CRISPRa Cell Surface and FNLCR CRISPRa Soluble Libraries
Pooled Library#1000000228DepositorAvailable SinceJan. 24, 2024AvailabilityAcademic Institutions and Nonprofits only -
pAAVS1-P-CAG-GFP
Plasmid#80491Purposedonor vector for AAVS1 targeting (puromycin selection) and constitutive GFP expressionDepositorInsertCAG-GFP
UseDonor vector (human)ExpressionMammalianPromoterCAGAvailable SinceNov. 28, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCX-DI-2A
Plasmid#74671PurposeMammalian expression of DI-2A (hCD73/F2A/hCD39)DepositorAvailable SinceFeb. 14, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAAV-Ef1a-mCherry
Plasmid#114470PurposemCherry ControlDepositorHas ServiceAAV PHP.eB, AAV Retrograde, AAV1, AAV2, AAV5, AAV8, and AAV9InsertmCherry
UseAAVPromoterEf1aAvailable SinceSept. 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
Pro-Code Vector Kit
Plasmid Kit#1000000177PurposeLentiviral plasmids with unique protein barcodes and gRNA cloning sites for CRISPR screens and tracking cell populations. Part of the Pro-Code Vector Kits.DepositorApplicationBarcoding, Genome EditingVector TypeLentiviral, Mammalian ExpressionEditing TypeCRISPRAvailable SinceSept. 3, 2021AvailabilityAcademic Institutions and Nonprofits only -
pDule2-3-nitroTyrosine (A7)
Plasmid#174079PurposePlasmid for incorporating the non-canonical amino acid 3-nitroTyrosine with the third generation Mj 3NY (A7) synthetase and cognate amber suppressing tRNA in Ecoli.DepositorInsert3-nitroTyrosine tRNA synthetase and cognate amber suppressing tRNA derived from M. jannaschii Tyrosine synthetase/tRNA system
ExpressionBacterialMutationY32H H70T D158H I159A L162RPromoterGlnRS (constitutive)Available SinceAug. 25, 2021AvailabilityAcademic Institutions and Nonprofits only -
pENTR4_G3BP2
Plasmid#127105DepositorInsertG3BP2 (G3BP2 Human)
UseGateway shuttling vectorAvailable SinceJuly 25, 2019AvailabilityAcademic Institutions and Nonprofits only -
CMV-mCherry
Plasmid#241313PurposeExpression of mCherry protein in mammalian cellsDepositorInsertmCherry fluorescent protein
TagsmCherryExpressionMammalianPromoterCMVAvailable SinceOct. 31, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-HA-CCND1
Plasmid#172649PurposeExpresses HA-tagged cyclin D1 in mammalian cellsDepositorAvailable SinceAug. 20, 2021AvailabilityAcademic Institutions and Nonprofits only -
pHR-Traditional CAR (anti-CD19)
Plasmid#192115PurposeLentiviral delivery of Traditional CAR(anti-CD19)DepositorInsertpHR-pEF1a-Traditional CAR (anti-CD19scFV_CD28_41BB_CD3z)
UseLentiviralAvailable SinceFeb. 8, 2023AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-C1-ADRP
Plasmid#87161PurposeFluorescent protein localized to lipid droplets (LDs)DepositorAvailable SinceMay 30, 2017AvailabilityAcademic Institutions and Nonprofits only